KEGG   Azospirillum lipoferum: AZOLI_2412Help
Entry
AZOLI_2412        CDS       T01658                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ali  Azospirillum lipoferum
Pathway
ali00330  Arginine and proline metabolism
ali00332  Carbapenem biosynthesis
ali01100  Metabolic pathways
ali01130  Biosynthesis of antibiotics
ali01230  Biosynthesis of amino acids
Module
ali_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AZOLI_2412 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    AZOLI_2412 (proB)
Enzymes [BR:ali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AZOLI_2412 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CBS87618
UniProt: G7Z9G2
Position
2266312..2267451
Genome map
AA seq 379 aa AA seqDB search
MALDAPTLLESRRLVVKIGSALLVDGETRQIRRDWLDALADDVAACRKRGQEVVIVTSGA
VACGREHLGLVGRALKLEEKQAAAATGQIRLAHAYQETLARHDVTVAQVLVTLEDTEERR
RHLNARNTIDTLLKLGAVPVINENDTVATAEIRFGDNDRLAARVAQMVSADTLVLLSDID
GLYTADPRKDPDARHIPTVRELTPEIEGMAGEPPPGYSSGGMVTKIAAARVALSAGCRMV
IAKGKRMNPLAALEQRPEDGGALCTWFLPSAEPTSARKAWIAGHVNATGVLVVDDGAMRA
LSHGASLLPAGVTAVQGEFDRGDVVIVRTQEGREVARGLVAYSADDARKILRHKSTEIPE
ILGYRGRDEMIHRDDLVVR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgacgcccctacccttctcgaatcccgccggctggtcgtgaagatcggctcg
gcccttctggtcgatggtgaaacccggcaaatccgccgggactggctcgacgcgctggcc
gacgacgtcgccgcctgccgcaagcgcggacaggaggtggtgatcgtcacctccggcgcc
gtcgcctgcgggcgggagcatctcggcctcgtcggccgggcgctgaagctggaggagaag
caggccgccgccgccaccggccagatccgccttgcccacgcctatcaggaaacgctggcc
cgccacgacgtcaccgtcgcccaggtgctggtgaccctggaggacacggaagaacgtcgg
cgccacctgaacgcccgcaacaccatcgataccctgctgaagttgggcgccgttcccgtc
atcaacgagaacgacacggtcgctaccgcggaaatccgtttcggcgacaatgaccggctg
gccgcccgcgtggcgcagatggtcagcgccgacacgctggttctgctgtcggacatcgac
ggcctctacacagccgacccgcgcaaggacccggacgcgcgccacatccccaccgtgcgc
gaactgacgccggagatcgagggcatggccggcgagccgccccccggctacagcagcggc
ggcatggtgaccaagatcgccgcggcgcgcgtcgccctgtcggccggctgccgcatggtc
atcgccaagggcaagcgcatgaacccgctggcggcgctggaacagcggccggaggatggc
ggtgcgctctgcacctggttcctgccctcggccgaacccaccagcgcccgcaaggcctgg
atcgccggccatgtcaacgccacgggcgtgctggtggtcgatgacggcgccatgcgcgcc
ctgtcccacggcgccagcctgctgccggccggcgtcaccgccgtgcagggcgaattcgac
cgcggcgacgtggtgatcgtccgcacccaggaagggcgcgaggtcgctcgcggcttggtc
gcctacagcgccgacgacgcccgcaagatcctgcgccacaagagcaccgagattccggag
atcctgggctatcggggacgcgacgagatgatccaccgcgacgatctggtggtgcggtga

DBGET integrated database retrieval system