KEGG   Azospirillum lipoferum: AZOLI_2494Help
Entry
AZOLI_2494        CDS       T01658                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ali  Azospirillum lipoferum
Pathway
ali00860  Porphyrin and chlorophyll metabolism
ali01100  Metabolic pathways
Module
ali_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ali00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AZOLI_2494
Enzymes [BR:ali01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     AZOLI_2494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBS87697
UniProt: G7Z2P8
Position
2352222..2352866
Genome map
AA seq 214 aa AA seqDB search
MNAVSLTPLTVTRWWLIRHAPVHNPDNVICGSSDREADTGNRAAAVSLSASLPADALWLT
SPLRRSRQTAQALWTRNPRLADTAVVEPELAEQDFGEWEGISHDTAAMRDAEAAARFWRD
PARHAPPSGESFATVMERTAAALRRLTGLHAGRDVVAVIHAGTIRGALALALDLTPEAAL
RLRIDPWSLTRIDHYHAGTGSWSVGGVNALPGTF
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggtgagcctcacccccctgaccgtcacccgctggtggctgatccgccatgcg
ccggtccacaaccccgacaacgtcatctgcgggtcgagcgaccgcgaggccgacaccggc
aaccgtgcggcggcggtatccctctcggccagcctccccgccgatgccctgtggctgacc
agcccgctccgccgcagccggcagaccgcgcaggcgctgtggacccgtaacccccggctt
gccgacacggcggtggtggagccggagctggccgagcaggatttcggcgagtgggagggc
atcagccacgacaccgcggcgatgcgcgatgcggaggcggcggcccgcttctggcgcgac
ccggcccgccacgccccgcccagcggcgagagcttcgccacggtgatggagcgcacggcg
gcggcgctgcggcggctgaccggcctccatgccggacgcgacgtggtcgcggtgatccat
gccggaaccatccgcggcgcgctggcgctggcattggatttgacgccggaggcggcgctg
cggctgcggatcgatccctggtcgctgacccggatcgaccactaccacgccgggacagga
tcctggtcggtcgggggagtgaacgcactgcccggaaccttttga

DBGET integrated database retrieval system