KEGG   Azospirillum lipoferum: AZOLI_2999Help
Entry
AZOLI_2999        CDS       T01658                                 

Gene name
tesA
Definition
(GenBank) multifunctional: acyl-CoA thioesterase I/protease I/lysophospholipase L1
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ali  Azospirillum lipoferum
Pathway
ali01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AZOLI_2999 (tesA)
Enzymes [BR:ali01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AZOLI_2999 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     AZOLI_2999 (tesA)
Lipid biosynthesis proteins [BR:ali01004]
 Fatty acid synthase
  Component type
   AZOLI_2999 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL OSK DUF3755
Motif
Other DBs
NCBI-ProteinID: CBS88168
UniProt: G7Z6X1
Position
complement(2819821..2820441)
Genome map
AA seq 206 aa AA seqDB search
MTVPTRADAAQPVKLLALGDSLTAGYGLPEPQGFTRQLEKALADKGYSVTVINAGVSGDT
TAGGRARLDWALADKPDAAIVELGANDMLRGLDPAQAKDNLDAILKTLKDRKIPTLLAGM
YASPSLGKPYTDKFNAIYPDLAKSYDLPLYPFFLDGVALERSLIQQDGLHPNAQGVAVIV
ERILPSVTALLDSLPQIQKTTEKPGG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttccgacccgtgcggacgccgcgcagccggtgaagctgctggcgctgggcgac
agcctgaccgccggctacggcctgccggaaccgcagggcttcacccgccaactggaaaag
gcgctggccgacaagggatacagcgtcaccgtcatcaatgccggcgtgtcgggcgacacc
accgccggcggtcgggcacggctggactgggcgctggccgacaagcctgacgccgccatc
gtggagctgggtgccaacgacatgctgcgcgggctcgatcccgctcaggcgaaggacaat
ctcgacgccatcctgaagacgctgaaggatcgcaagattccgaccctgctggccggcatg
tacgcctcccccagtttgggaaagccctataccgacaagttcaacgccatctacccggac
ttggcgaagagctatgacctgccgctctaccccttcttcctcgacggggtggcgctggaa
cggtcgctgatccagcaggacgggctgcatcccaatgcccagggcgtggcggtgatcgtg
gagcgaatcctgccgtccgtcaccgccctgctcgacagtctgccgcaaatccagaagact
accgaaaaacccggaggctga

DBGET integrated database retrieval system