KEGG   Azospirillum lipoferum: AZOLI_p10029Help
Entry
AZOLI_p10029      CDS       T01658                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ali  Azospirillum lipoferum
Pathway
ali00071  Fatty acid degradation
ali00072  Synthesis and degradation of ketone bodies
ali00280  Valine, leucine and isoleucine degradation
ali00310  Lysine degradation
ali00362  Benzoate degradation
ali00380  Tryptophan metabolism
ali00620  Pyruvate metabolism
ali00630  Glyoxylate and dicarboxylate metabolism
ali00640  Propanoate metabolism
ali00650  Butanoate metabolism
ali00900  Terpenoid backbone biosynthesis
ali01100  Metabolic pathways
ali01110  Biosynthesis of secondary metabolites
ali01120  Microbial metabolism in diverse environments
ali01130  Biosynthesis of antibiotics
ali01200  Carbon metabolism
ali01212  Fatty acid metabolism
ali02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZOLI_p10029 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    AZOLI_p10029 (atoB)
   00640 Propanoate metabolism
    AZOLI_p10029 (atoB)
   00650 Butanoate metabolism
    AZOLI_p10029 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AZOLI_p10029 (atoB)
   00072 Synthesis and degradation of ketone bodies
    AZOLI_p10029 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZOLI_p10029 (atoB)
   00310 Lysine degradation
    AZOLI_p10029 (atoB)
   00380 Tryptophan metabolism
    AZOLI_p10029 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZOLI_p10029 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZOLI_p10029 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AZOLI_p10029 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ali04147]
    AZOLI_p10029 (atoB)
Enzymes [BR:ali01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZOLI_p10029 (atoB)
Exosome [BR:ali04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZOLI_p10029 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CBS88354
UniProt: G7Z9Y4
Position
AZO_p1:complement(27923..29104)
Genome map
AA seq 393 aa AA seqDB search
MTDSIVIAAAVRTPMGGFQGDLMGLTGPQLGAVAIQAALERSGLAADAVDEVFMGNVLSA
GLGQAPARQAALGAGLPKGVGCTTISKVCGSGMRAVMFAHDVIKAGSAKVVVAGGMESMS
NAPYLLDRARAGYRMGHGKVLDHMFFDGLEDAYEKGRLMGTFAEECAGSYGFTREAQDNY
AIESLNRARKAVEDGSFKAEIAPVLVKGRKGDTLVDTDEQPGKGDPKKIPTLKPAFAKDG
TVTAANASSISDGGAALIVTTRSEADRRGLRVIAEIKGHSNHAQQPALFTTAPVGAMQKL
FEKVGWSARDVDLFEINEAFAVVTMAAMRDLDLPHDKVNVHGGACALGHPIGASGARIIV
TLLAALEKYDLKRGVASLCIGGGEATAIAVERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacagcatcgtcatcgccgccgccgtccgcacgccgatgggcggcttccagggc
gacctcatgggcctgaccggcccgcagctgggcgccgtcgccatccaggcggcgctggag
cgctcgggcctcgccgcggacgcggtggacgaggtgttcatgggcaacgtgctgtcggcc
gggctgggccaggccccggcgcgtcaggcggcgctgggcgccggtctgccgaagggtgtc
ggctgcaccaccatctccaaggtctgcggctcgggcatgcgggcggtgatgttcgcccat
gacgtgatcaaggccggctcggccaaggtcgtggtggccggcggcatggagagcatgtcg
aacgccccctatctgctggaccgcgcccgcgccggctaccgcatgggtcacggcaaggtg
ctggaccacatgttcttcgacggtctggaggatgcctacgagaagggccgcctgatgggc
accttcgccgaggaatgcgccggcagctacggcttcacccgcgaggcgcaggacaactac
gccatcgaaagcctgaaccgcgcccgcaaggcggtggaggacggctccttcaaggcggag
attgcgccggtgctggtcaagggccgcaagggcgatacgctggtcgacaccgacgagcag
ccgggcaagggcgatcccaagaagatcccgacgctgaagcccgcctttgccaaggacggc
acggtgacggcggcgaacgcctcgtcgatctccgacggcggcgcggcgctgatcgtcacc
acccgcagcgaggcggaccgccgcggcctgcgcgtgatcgccgagatcaagggccattcc
aaccacgcccagcagccggcgctgttcacgacggccccggtgggtgcgatgcagaagctg
ttcgagaaggtgggctggtcggcccgcgatgtcgacctgttcgagatcaacgaagccttt
gcggtcgtcactatggcggcgatgcgcgatctggatctgccgcacgacaaggtgaacgtc
catggcggcgcctgcgcgctcgggcatccgatcggggcttcgggggcgcggatcatcgtg
acgctgctggcggcgctggagaagtacgatttgaagcggggcgtggcttcgctgtgtatc
ggtgggggtgaggcgacggcgattgcggtggagcgggtgtaa

DBGET integrated database retrieval system