KEGG   Azospirillum lipoferum: AZOLI_p10102Help
Entry
AZOLI_p10102      CDS       T01658                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ali  Azospirillum lipoferum
Pathway
ali00500  Starch and sucrose metabolism
ali01100  Metabolic pathways
ali01110  Biosynthesis of secondary metabolites
Module
ali_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZOLI_p10102 (glgB)
Enzymes [BR:ali01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AZOLI_p10102 (glgB)
Exosome [BR:ali04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZOLI_p10102 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM Arm-DNA-bind_3
Motif
Other DBs
NCBI-ProteinID: CBS88420
UniProt: G7ZB40
Position
AZO_p1:108475..110790
Genome map
AA seq 771 aa AA seqDB search
MASDMTTDTRKDQAQTGVPESRSNEQEAANRRPADHRAEALRAAADAIARADHGDPFAVL
GMQQEAPGRPVEVRAFVPGAEKLWVIDSATGEPAGEAERIHQDGFYLAVMPDRTERFRYR
LRARYPLATQEFEDAYRFGNMLGELDVHLLAEGTHLRNYEKLGAHPREVDGVAGVSFAVW
APSARSVSVVGDFNNWDGRRLPMRRRVEVGVWEIFVPGAHAGQRYKFEIRGPNGNLLPAK
ADPYAFQAEMRPATASVIHGLPSYEWRDLEWQSRKVATSDRTAPISIYEVHLGSWARVPE
EDNRFLTYQELAERLIPYAKDMGFTHIELLPITEHPFDGSWGYQPIGLYAPTARHGSPED
FKDFVNACHRAGLGVLLDWVPGHFPTDPHGLGDFDGTHLYEHADPRQGFHQDWNTLIYNF
GRTEVQNFLLGNALFWLDHYKLDGLRVDAVASMLYLDYSRKEGEWVPNKFGGRENLESIA
FLKRMNELVYGQQPGAMTVAEESTSWPMVSKPTYLGGLGFGYKWNMGWMHDTLHYMQNDP
IHRRYHHHQMTFGLIYQFSENFVLPLSHDEVVHGKGSLINKMPGDDWQKFANLRAYYGFM
FAHPGKKLLFMGGEFAQWSEWSEARSLDWHLLDQPMHRGMRDLVRDLNGVYRELEPLHKT
DCDPSGFEWIESNDNENSVFTFLRKADESGHIVIAVCNFTPIPRYGYRVGVPLPGRYVER
INTDDAKYGGSGVGNPGGGIYAEETPWHGRTHSLDLTIPPLSTLILERKAE
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgacatgacgacggacacccgcaaggaccaggcgcagaccggcgtccccgaa
agccgttccaacgaacaggaggccgcgaatcggcggcccgccgatcaccgggccgaggcc
ctgcgtgcggcggcggacgccatcgcgcgggccgaccatggcgatcccttcgccgtgctg
ggcatgcagcaggaggcgcccggccggccggtggaggtccgcgccttcgtgcccggcgca
gaaaagctgtgggtgatcgacagcgccaccggcgaaccggcgggcgaggccgagcgcatt
caccaggacggcttctacctcgcggtgatgcccgaccggacggagcgcttccgctaccgc
ctgcgcgcccgatacccgctggcgacccaggagttcgaggacgcctaccgcttcggcaac
atgctgggcgagctggacgtccatctgctggccgagggcacccacctgcgcaattacgag
aagctgggcgcccacccgcgcgaggtcgacggcgtcgccggcgtgtccttcgccgtctgg
gcgccgagcgcccgcagcgtcagcgtggtcggcgacttcaacaactgggacggccgccgc
ctgccgatgcgccggcgcgtcgaggtcggcgtctgggagatcttcgttcccggcgcccat
gccggccagcgctacaagttcgagatccgcgggcccaacggcaacctgctgccggccaag
gccgacccctacgccttccaggcggagatgcgcccggccaccgcctcggtcatccacggc
ctgccgtcctacgaatggcgggacctggagtggcagagccgcaaggtcgccacctccgac
cgcaccgcgccgatctccatctacgaggtgcatctgggctcctgggcacgggtgccggag
gaggacaaccgcttcctgacctatcaggaactggcggagcggctgatcccctacgccaag
gacatgggcttcacccatatcgagctgctgccgatcaccgagcatccgttcgatgggtcc
tggggctaccagcccatcggcctctatgccccgacagcccgccacggctcgccggaggac
ttcaaggacttcgtcaacgcctgccaccgcgccgggctgggcgtgctgctggactgggtg
cccggccatttcccgaccgatccgcacgggctgggcgatttcgacggcacgcatctctac
gagcatgccgatccgcgccagggcttccaccaggattggaacaccctgatctacaatttc
ggccggacggaggtgcagaacttcctgctgggcaacgcgctgttctggctcgaccattac
aagctggacgggcttcgcgtcgatgccgtcgcctccatgctctatctcgactacagccgc
aaggaaggggagtgggtccccaacaagttcggcggtcgcgagaacctcgaatccatcgcc
ttcctcaagcgcatgaacgagctggtctatggccagcagccgggcgcgatgacggtggcg
gaggaatccacgtcatggccgatggtgtcgaagccgacctatctcggcggtctcggcttc
ggctacaaatggaacatggggtggatgcacgacacgctgcattacatgcagaacgacccg
atccaccgccgctaccatcaccaccagatgaccttcgggctgatctatcagttctccgag
aacttcgtcctgccgctcagccatgacgaggtggtccacggcaagggctcgctgatcaac
aagatgccgggcgacgactggcagaaattcgccaacctgcgcgcctattacggcttcatg
ttcgcccaccccggcaagaagctgctgttcatgggcggcgagtttgcccagtggagcgag
tggagcgaggcgcggagcctggactggcatttgctggaccagcccatgcaccggggcatg
cgcgacctcgtgcgcgacctgaacggcgtctatcgcgagctggagccgctgcacaagacc
gactgcgacccgtccggcttcgagtggatcgagtcgaacgacaacgagaactcggtcttc
accttcctgcgcaaggccgacgagtccgggcacatcgtcatcgccgtctgcaacttcacg
ccgattccccggtacggctaccgcgtcggcgttccgctgcccggccgctatgtggagcgg
atcaacaccgacgacgcgaagtatggcggcagcggcgtcggcaaccccggcggcggcatc
tatgccgaggaaaccccctggcatggccgcacccactcgctcgacctgaccatcccgccg
ctgtcgacgctgattctggagaggaaggcggagtag

DBGET integrated database retrieval system