KEGG   Azospirillum lipoferum: AZOLI_p10769Help
Entry
AZOLI_p10769      CDS       T01658                                 

Gene name
nagZ
Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ali  Azospirillum lipoferum
Pathway
ali00520  Amino sugar and nucleotide sugar metabolism
ali01100  Metabolic pathways
ali01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AZOLI_p10769 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    AZOLI_p10769 (nagZ)
Enzymes [BR:ali01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AZOLI_p10769 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: CBS88980
UniProt: G7ZBY2
Position
AZO_p1:complement(774510..775592)
Genome map
AA seq 360 aa AA seqDB search
MGHRPAGSITPVVHPRAVVFGCAGLEVTPDEAAFFRDADPLGFILFRRNCDSRDQMRRLV
DDLRASVGRPDAPVLIDQEGGRVARMRPPHWPAHPPMGVFGALAGRDADAGREAAQEAAR
EAAWINGRLLAHMLAEVGITVDCAPVCDVPVEGAHDIIGDRAFSRDPAVVIALARATAEG
LLAGGVLPVLKHIPGHGRAFADSHAELPVVEADRAVLEATDFAPFRALADLPLAMVAHVV
LKAIDPTAPASTSPIVVREVVRGPSIGFGGLLFSDDLSMNALQGDPRKRAEAVLAAGMDV
VLHCNGELDEMRSLLGAVPVLSGAAAERWARAEAMRHAPEPADIAALTNRLAELLGPAQT
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgggccatcggcctgcgggctccatcaccccggtcgtccatccgcgcgcggtcgtcttc
ggctgcgccgggctggaggtgacgcccgacgaggcggccttcttccgcgatgccgatccg
ctcggctttatcctgttccgccgcaactgcgacagccgcgatcagatgcgccggctggtc
gacgacctgcgcgccagcgtcggccggccggatgctcccgtcctgatcgaccaggagggc
ggccgggtcgcgcgcatgcgcccgccgcactggccggcccatccgccgatgggcgtgttc
ggcgcgctggccgggcgcgatgccgacgccgggcgcgaagcggcccaagaggctgcccga
gaggccgcctggatcaacggccggctgctcgcccatatgctggcggaggtcggcatcacg
gtggattgcgcgcctgtgtgcgatgtcccggtggagggggcgcacgacatcatcggcgac
cgcgccttctcgcgcgatcccgccgtggtgatcgcgctggcccgcgccaccgccgaaggg
ctgctggccggcggcgtgctgccggttctcaagcacatccccggccatggccgggccttc
gccgacagccatgccgagctgccggtggtggaggccgaccgcgcggtgctggaggccacc
gacttcgcccccttccgcgcgctggccgatttgccgctggcaatggtggcgcatgtggtt
ctgaaggccatcgacccgaccgcaccggccagcacgtcgcccatcgtggtgcgcgaggtg
gtgcgggggccgtccatcggtttcggcgggctgctgttcagcgacgatctgtcgatgaac
gcgctgcagggcgatccgcgcaagcgggcggaagcggtgctggcggcgggcatggatgtc
gtgctccactgcaatggcgaacttgacgagatgcggtcgctgctcggcgccgttccggtg
ctgagcggtgccgcggcggagcgctgggcgcgggccgaggcgatgcgccatgcgccggaa
cccgcggacatcgcggcattgacgaaccggctggccgagcttctcggcccggcccagacc
tga

DBGET integrated database retrieval system