KEGG   Azospirillum lipoferum: AZOLI_p10930Help
Entry
AZOLI_p10930      CDS       T01658                                 

Definition
(GenBank) putative (S)-2-haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
ali  Azospirillum lipoferum
Pathway
ali00361  Chlorocyclohexane and chlorobenzene degradation
ali00625  Chloroalkane and chloroalkene degradation
ali01100  Metabolic pathways
ali01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ali00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AZOLI_p10930
   00361 Chlorocyclohexane and chlorobenzene degradation
    AZOLI_p10930
Enzymes [BR:ali01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     AZOLI_p10930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2
Motif
Other DBs
NCBI-ProteinID: CBS89120
UniProt: G7ZAZ6
Position
AZO_p1:complement(936774..937442)
Genome map
AA seq 222 aa AA seqDB search
MSQFRPKYVTFDCHGTLINFQMAVAARDLYGSILDEARMTEFIKNFSAYRLDEIMGDWKP
YADVVHNALERSCKRNNVVFREEDARMVYERVPTWGPHADVPAGLAKVAKEIPLVILSNA
MNDQIPSNVAKLGAPFHAVYTAEQAQAYKPRFKAFEYMFDMLGCGPEDILHCSSSFRYDL
MSAHDLGIRNKVWVNRGHEPANPYYGYTEIRDISGLPGVVGL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagccagttccggccgaaatacgtcaccttcgattgccacggcacgctgatcaacttt
cagatggcggtggccgcgcgcgatctgtacggctcgatcctcgacgaagcgcggatgacg
gagttcatcaagaatttctccgcctaccgcctcgacgagatcatgggcgactggaagccc
tacgccgatgtcgtccacaatgcgctggagcgcagctgcaagcgcaacaacgtcgtcttc
cgcgaggaggacgcgcgcatggtctatgagcgggttccgacctgggggccgcacgccgac
gtgccggccgggctggcgaaggtggccaaggaaattccgctggtcatcctgtccaacgcc
atgaacgaccagattccgtcgaatgtggcgaagctgggcgcgcccttccacgccgtctac
accgccgaacaggcgcaggcctacaagccgcgcttcaaggccttcgaatacatgttcgac
atgctcggctgcgggccggaggacatcctgcactgctcctcctccttccgctacgacctg
atgtcggcgcatgacctggggatccgcaacaaggtgtgggtcaaccgcggccacgaaccg
gccaacccctattacggctataccgagatccgcgacatctccggtctgcccggcgtggtc
gggctttaa

DBGET integrated database retrieval system