KEGG   Azospirillum lipoferum: AZOLI_p30488
Entry
AZOLI_p30488      CDS       T01658                                 

Definition
(GenBank) putative type VI secretion protein, FHA domain-containing
  KO
K11913  type VI secretion system protein
Organism
ali  Azospirillum lipoferum
Pathway
ali03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ali00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AZOLI_p30488
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ali02044]
    AZOLI_p30488
Secretion system [BR:ali02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   AZOLI_p30488
SSDB
Motif
Pfam: FHA Yop-YscD_cpl UPRTase
Other DBs
NCBI-ProteinID: CBS90303
UniProt: G7ZFI3
Position
AZO_p3:524271..525887
AA seq 538 aa
MLRLRIVSDHRASLGGNAEKTLHGGDLTVGRGVENGWILPDPDLLLSRQHCVFEKTAAGY
RVIDTSTNGVFLNGSDRPLGRNVPAALGSGDRIRIGRFIIEATVETLSAPSFTEISGAFR
LGGTDSAPDPFAPDPFAPPPPAAAAPDRFDELFADPLAGSVEQRPFEHRPLRSEEAPFDA
WTASSSGAAPRERADDWRFGTVDDHSDPLNQSLSIGVSYQPPAAAPPPSGGGIPDDWDDE
LFAPPKPAASTVPHPAFPAAAKTAQPLPEDWNIDETLPDPAADPLPAEPSPVARVAEPIP
LPDDSVIVPHAVPQVVPPPPAPVSPPAPLAAPVTDAGAAVAAFYEGFGAPLPADGLPDPT
ATMRNLGEALRVSLGALHASLRARSRFKDEFHLEQTSFRPAGENPLKRCETLDEAVSVLA
NPRLRGFLPMADAVREAASDVQVHHLAYAAALQTALKQVVAKFDPGALSQRLETRLLDSI
VPAARKARYWDQYETLYKDLVVELEEDFDRVIGDAIAREYDRFVRGDTGRDPEGGSPD
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgctgaggctgaggatcgtttcggaccatcgggcgtcgctgggcggcaatgccgagaag
acgctgcatggcggcgacctcaccgtcgggcgcggggtcgagaatggctggatcctcccc
gatcccgacctgctgctgtcgcgccagcactgtgtcttcgagaagaccgcggccggctac
cgggtgatcgacaccagcaccaacggcgtcttcctcaacggttccgaccggccgctcggc
cgcaatgtgccggcggctctcgggtcgggcgaccgtatccgcatcggtcgcttcatcatc
gaggcgacggtggaaacgctgtccgcccccagcttcaccgagatttccggcgccttccgg
ttgggcgggaccgatagcgcgcccgatcccttcgcccccgatcccttcgccccgccgccg
cccgctgccgcggcaccggaccggttcgacgagctgttcgccgaccccctcgccggttcc
gtcgagcagcgcccgttcgaacaccggccgctgcggtcggaagaggcgcccttcgatgcc
tggaccgcgtccagcagcggtgcggcgccgcgcgagcgggcggacgactggcggttcggc
acggtggacgaccattccgacccgctgaaccagtcgctgtccatcggcgtctcgtatcag
ccgcctgccgccgcaccgccgccgtcgggcgggggcatccccgacgactgggacgacgag
ctgttcgccccgccgaagccggcggcctccaccgtcccgcacccggccttccccgccgcg
gcgaagacggcccagccgttgccggaagactggaacatcgacgagacgctgcccgatccg
gcggccgatccgctgccggcggagccgtcgccggtcgcccgggtggccgagccgatcccg
ctgccggacgactccgtcatcgttccccacgcggtgccgcaggtcgtgccgccgccgccc
gcgcccgtgtcccctcccgcgccgctcgccgcgcccgttaccgacgcgggtgccgcggtc
gccgccttctatgaggggttcggcgcgccgctgccggcggacgggctgccggacccgact
gcgacgatgcgcaacctgggcgaggcgctgcgcgtcagcctgggggcgctgcatgcgtcg
ctgcgggcgcgctcccgtttcaaggacgagttccatctggagcagaccagcttccgcccg
gcgggggagaacccgctgaagcggtgcgagacgcttgacgaggcggtgtcggtgctggcc
aacccgcgcctgcgcggcttcctgccgatggccgacgcggtgcgcgaggcggcgagcgat
gtgcaggtccaccacctcgcctatgccgcggcgctgcagaccgcgctgaagcaggtggtc
gccaagttcgatcccggcgcgctcagccagcggctggagacgcggcttctcgacagcatc
gttccggcggcgcgcaaggcccgctactgggaccagtacgagacgctctacaaggatctg
gtggtcgagctggaagaggatttcgaccgggtgatcggcgacgccatcgcccgcgaatac
gaccgcttcgtgcgcggcgacaccggccgggatccggagggcggatcgccggactga

DBGET integrated database retrieval system