KEGG   Azospirillum lipoferum: AZOLI_p40212Help
Entry
AZOLI_p40212      CDS       T01658                                 

Gene name
pit
Definition
(GenBank) low-affinity phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ali  Azospirillum lipoferum
Brite
KEGG Orthology (KO) [BR:ali00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AZOLI_p40212 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CBS90607
UniProt: G7ZFY7
Position
AZO_p4:complement(208975..209988)
Genome map
AA seq 337 aa AA seqDB search
MDALQLALPAIVFIVFVALAFDFINGLHDAANSIATVVSTRVLSPKLAVLWAAFFNFIAF
LFFGLHVATTIGTGLVDPLVMDPAVILAALIGAIGWNLITWYLGLPSSSSHALVGGIAGA
GIAKAGFGAIIASGFTKTAVAIVLSPGIGLLLALLLMLVVSWVLRRAAPFTVDRQFRHLQ
LVSAALYSLGHGGNDAQKTMGIIAVLLFSQGMLGDTFYVPFWVIITCQAAMGLGTMMGGW
RIVRTMGSRITDLKPYQGFCAETAGAITLFGATWLGIPVSTTHTITGAIVGVGSARRTSA
VRWGLAGRIVWAWVLTIPASGIVAALSYLLVAGLLRP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggacgccctccagctcgccctgccggcgatcgtcttcatcgtcttcgtggcgctcgcc
ttcgacttcatcaacggcctgcacgacgcggcgaactccatcgccaccgtggtgtcgacc
cgcgtgctgtcgcccaagctggccgtgctgtgggcggccttcttcaacttcatcgccttc
ctgttcttcggcctgcatgtcgccaccaccatcggcaccggtctggtcgatccgctggtg
atggacccggcggtgatcctggcggcgctgatcggcgccatcggctggaacctgatcacc
tggtatctcgggctgccgtcctcgtcgtcccatgcgctggtcggcggcatcgccggggcc
ggcatcgccaaggccggcttcggcgccatcatcgccagcggcttcaccaagacggcggtc
gccatcgtgctgtcgccgggcatcggcctgctgctggccctgctgctgatgctggtggtg
tcctgggtgctgcgccgcgccgcccccttcacggtcgaccgacagttccgccatctccag
ctcgtctccgccgcactctacagcctgggccatggcggcaacgacgcgcagaagacgatg
ggcatcatcgccgtcctgctgttcagccagggcatgctgggcgataccttctacgtgccc
ttctgggtcatcatcacctgtcaggcggcgatggggctgggcaccatgatgggcggctgg
cgcatcgtccgcaccatgggctcgcgcatcaccgacctgaagccctatcagggcttctgc
gccgagaccgcgggcgccatcacgctgttcggcgcgacgtggctgggcattccggtttcg
accacccacaccatcaccggcgccatcgtcggcgtcggctccgcccgccgcacctcggcg
gtgcgctggggtctggccggccgaatcgtctgggcctgggtgttgacgattcccgcctcc
ggcatcgtcgccgccctgtcctacctgctggtggccggcctgctgcgcccgtag

DBGET integrated database retrieval system