KEGG   Azospirillum lipoferum: AZOLI_p40237Help
Entry
AZOLI_p40237      CDS       T01658                                 

Gene name
cobB
Definition
(GenBank) Cobyrinic acid a,c-diamide synthase
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
ali  Azospirillum lipoferum
Pathway
ali00860  Porphyrin and chlorophyll metabolism
ali01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ali00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AZOLI_p40237 (cobB)
Enzymes [BR:ali01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     AZOLI_p40237 (cobB)
    6.3.5.11  cobyrinate a,c-diamide synthase
     AZOLI_p40237 (cobB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA MobB Fer4_NifH FtsK_gamma AAA_25
Motif
Other DBs
NCBI-ProteinID: CBS90629
UniProt: G7ZFZ7
Position
AZO_p4:complement(231475..232803)
Genome map
AA seq 442 aa AA seqDB search
MPERTMAKGLIIAAPASGTGKTTLTLGLLAALRARGVAVGAVKSGPDYIDPAFHRAATGR
PSVNLDTWAMGPDLLDGLAARAAEGADLLVCEALMGLFDGVAGVGATGTGSTAEIAARTG
WPVLLVVNAKGQSQSAAALVKGFATYRDDVTIGGVVLNNVGSPRHTALAGNAIEALGIPL
LGALPRASDLSLPERHLGLVQADETEGLADRLAALGRFVAEHVDLDRVVALAKPSKAGPG
SDAPALPPLGQRIAIARDAAFTFVYPHLTAGWQAAGAELCFFSPLADEAPSPDADAVYLP
GGYPELHAGRLAANHAFRDGLRAAAERVPVYGECGGYMVMGETLEDADGVSHPMTGLLGV
RTSFAKRRLHLGYRRAALLADGPLGPAGSPLMGHEFHYASTLARGNDAPLLHATAADGSD
LGALGSRRGLALGSFVHLIARG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgccagagagaacaatggctaagggcctcatcatcgccgccccggcctcgggcaccggc
aagaccaccctgacgctggggctgctggcggcgctccgcgcccgcggcgtggcggtgggg
gcggtgaagtcggggccggactacatcgacccggccttccaccgcgccgccaccggccgg
ccgagcgtgaacctcgacacatgggcgatggggccggacctgctggacgggctggccgcc
cgcgccgccgagggcgccgacctgctggtctgcgaagcgctgatgggcctgttcgacggg
gttgccggcgtcggcgccaccggcaccggctcgacggcggagatcgcggcgcgcaccggc
tggccggtgttgctggtggtgaacgccaagggccagtcgcagtcggccgcagcattggtg
aagggcttcgccacctaccgcgacgacgtgaccatcggcggcgtcgtgctgaacaatgtc
ggcagcccgcgccacaccgcgctggccggcaacgccatcgaggcgctgggcattccgctg
ctgggcgccctgccccgcgcgtcggatctcagcctgcccgaacgccacctcggcctcgtc
caggccgacgagacggaggggctggccgaccggctggccgcgctcggccgcttcgtcgcc
gagcatgtcgatctcgaccgcgtcgtcgcgctggcgaaaccgtcgaaggccggtcccggc
agcgatgcccccgccctgccgccgctgggccagcgcatcgccatcgcgcgggatgccgca
ttcaccttcgtctatccgcacctgaccgccggctggcaggccgccggggcggagttgtgt
ttcttctcccccctggcggacgaagcgccctcgccggatgccgatgccgtctatctgccc
ggcggctatccggagctgcatgccggccgcctcgccgccaatcacgccttccgcgacggg
ctgcgcgcggcggcggagcgggtgccggtctatggcgagtgcggcggctacatggtgatg
ggggagacgctggaggatgccgacggcgtctcccacccgatgaccgggctgctgggggtg
cgcacctccttcgccaagcgtcggctgcatctgggctatcgccgggcggctctgctggcc
gacgggccgctgggaccggcgggatcgccgctgatggggcacgagttccactatgcctcg
acccttgcccgcggcaacgacgcgccgctgctgcatgccacggcagcggacggcagcgac
ctgggcgcgctcggcagccggcgcggactggcgctggggtccttcgtccacctgatcgcg
cgggggtaa

DBGET integrated database retrieval system