KEGG   Austrofundulus limnaeus (annual killifish): 106511383Help
Entry
106511383         CDS       T06063                                 

Definition
(RefSeq) deoxyribonuclease-2-alpha-like isoform X1
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04142  Lysosome
Brite
KEGG Orthology (KO) [BR:alim00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106511383
Enzymes [BR:alim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     106511383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 106511383
NCBI-ProteinID: XP_013855597
UniProt: A0A2I4AJD5
Position
Unknown
AA seq 351 aa AA seqDB search
MGSLFSVGILFQLCDCDVKCRNDDGEEVDWFILYKLPNEKDAGLSYLYMDESTNGWKLSK
KKINSRTGSLGNTLKPLLDFYKRKTEGFGYILYNDQPPDPYAAPSSFGHSKGVVMLDRQS
XLWLSHSTPKFPAYRKQDFWPNSGNTNAQTFLCVHFPKGQFKAIGVQLKYIHAYSFDSEV
TQAFPEELRCVAQRSCYPKTHPWSSVQMLTSVMGRNFTSFAKYGRFKDDLYLGLIADYVS
EDLFVKGWGKLRDPLTSSCSSELTPHIYNVKEVKLQRRKAFSDTLDHSKWCVTSDGSLTC
IADMNRERSQMERGGGAICTDDAVVGNTFRASISQYERCKKPHSDIRKREL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggatccctcttcagtgttggcatcttgtttcagctgtgtgattgtgacgtgaaatgc
agaaaygacgatggggaggaagttgactggtttattttgtacaagctgcccaatgagaag
gatgctggtttgtcgtatttgtacatggacgagagcacgaatgggtggaaactcagcaaa
aagaaaatcaacagtagaactggctctttagggaacacgctgaaacctcttcttgatttc
tataaaagaaagactgaaggttttggttacatactctayaatgatcaacctccagatcca
tatgctgctccttcttcttttggacacagcaaaggggttgtgatgttggatcgacaaagc
rgcctttggctttcacacagtacacctaaattcccagcctatcgcaaacaagacttctgg
ccaaacagtgggaacacaaacgctcaaacrtttctgtgtgttcattttcccaaaggacaa
tttaaagcaataggagtgcagctcaaatacatccatgcttattcgttcgactcggaggta
actcaggcttttcctgaggagctgcggtgtgttgcacagagaagctgctacccaaaaaca
catccctggtccagtgtgcagatgctgacctctgtcatggggcgcaacttcaccagcttt
gcaaaatatggacgctttaaagatgatctttacttgggcctcattgcagactacgtttca
gaggatttatttgtaaaaggctgggggaaactgcgtgaccctctcacctcgagctgcagc
tcagagctcactcctcacatctacaacgtgaaggaagtgaagctccagaggaggaaggcc
ttcagtgacacactggatcactccaagtggtgtgtgacgtcagacggcagcctgacctgc
atcgctgatatgaacagagagaggagtcagatggagagaggcggaggagccatctgtact
gatgacgctgtggttgggaacaccttcagagcatcaatctctcagtatgaacgatgtaaa
aagcctcactcagatattagaaagagagaactgtga

DBGET integrated database retrieval system