KEGG   Austrofundulus limnaeus (annual killifish): 106513241Help
Entry
106513241         CDS       T06063                                 

Definition
(RefSeq) alcohol dehydrogenase class-3-like
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim00010  Glycolysis / Gluconeogenesis
alim00071  Fatty acid degradation
alim00350  Tyrosine metabolism
alim00830  Retinol metabolism
alim00980  Metabolism of xenobiotics by cytochrome P450
alim00982  Drug metabolism - cytochrome P450
alim01100  Metabolic pathways
alim01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:alim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106513241
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106513241
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106513241
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    106513241
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106513241
   00982 Drug metabolism - cytochrome P450
    106513241
Enzymes [BR:alim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     106513241
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     106513241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 UDPG_MGDP_dh_N TrkA_N
Motif
Other DBs
NCBI-GeneID: 106513241
NCBI-ProteinID: XP_013857419
UniProt: A0A2I4API3
Position
Unknown
AA seq 378 aa AA seqDB search
MATAGQVIRCKAAVAWEPGRPLSVVEVEVAPPKAHEVRIKVVATGVCHTDWECLYEARKG
TILRRFPLVLGHEAAGIVESVGPGVTTFSPGDKVIPLFLPFCNNCQLCHSSKTNLCKTNW
ANTQSGVLADGTSRISCNGQQIYQFLGVSSFCQYTVVPETSVTKIRPDAPLDKVCLLGCG
VSTGYGAAINAGKVQKDSSCIVFGLGAVGLAAIMGCKACHAKTIIGVDINPEKFEKAKQF
GATRCINPRDHSKPIQEVLVEMSNGGVDYALECVGSPAIMSAALDSTTEAGGTCVIAGWT
ETESINVQVIKLLMGRTLTGTYFGGWKSVKDVPKLVEKYMNKELQLDEFITHNMPLDQIN
EAFELLKNGKSIRTVISL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagctggtcaggtgatccggtgtaaagcagctgttgcctgggaacctgggagg
cctctgtctgttgtggaagtggaagtggccccacctaaagctcatgaagtcaggatcaag
gtggttgccacgggggtgtgtcacacggactgggaatgcctgtacgaggctcggaaaggg
acgattttaaggcggttccctttagtgctyggccacgaggcggcgggaatagtggagagt
gtcggcccaggagtcaccacattttcccctggggataaagtcattcctctttttctgcca
ttctgcaacaactgccaactgtgtcacagttccaaaacaaacctctgcaagacaaactgg
gcgaacacacaatcaggtgttttggctgatggcacaagcaggatatcttgcaatgggcag
cagatctatcagttccttggtgtcagctccttctgtcagtacacggtggttcctgagaca
tcggttacaaaaataagacctgacgcgccgctggataaagtctgtctgcttggctgcggc
gtctccaccggttatggggctgcaattaatgcaggcaaggtccaaaaggattcgtcgtgc
atcgtgtttgggctgggagctgttggtctggctgccatcatgggctgcaaggcatgtcac
gccaaaaccatcatcggggtcgacattaaccctgagaagtttgagaaagccaagcagttt
ggggccactcgttgtatcaacccgagagatcacagcaagcccatccaggaggttctggtg
gagatgagtaacggaggagtggactacgctctggagtgtgttggaagtccagccattatg
agcgcagcactggactccacgacagaagccggcggcacctgcgtcattgccggatggacg
gagacagaatcaataaacgttcaggttatcaagctcctgatgggacgcaccctgaccgga
acttattttggaggctggaagagtgtaaaggacgttcctaaactcgtggaaaagtacatg
aacaaggagttgcagctggatgagtttatcactcacaacatgccactggatcagatcaat
gaggcctttgagcttctgaaaaayggtaaaagcattcgtactgtcatcagtctttaa

DBGET integrated database retrieval system