KEGG   Austrofundulus limnaeus (annual killifish): 106513301Help
Entry
106513301         CDS       T06063                                 

Gene name
mapkapk2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04218  Cellular senescence
alim04370  VEGF signaling pathway
alim04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106513301 (mapkapk2)
   04370 VEGF signaling pathway
    106513301 (mapkapk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    106513301 (mapkapk2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106513301 (mapkapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:alim01001]
    106513301 (mapkapk2)
Enzymes [BR:alim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106513301 (mapkapk2)
Protein kinases [BR:alim01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   106513301 (mapkapk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 106513301
NCBI-ProteinID: XP_013857516
UniProt: A0A2I4APX6
Position
Unknown
AA seq 381 aa AA seqDB search
MISKVKNQFQNPGGQQNPTGQFVPFHPRPNLQIKKNAITDDYKITSQVLGLGINGKVLEI
FQKNTEDKYALKMLQDCPKARREVELHWRASPCANIVRIVDVYENLYQGRKCLLIVMECM
DGGELFSRIQDRGDQAFTEKEASDIMKSIGEAIQFLHAINIAHRDVKPENLLYSSKRPSA
LLKLTDFGFAKETTSHNSLNTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYP
PFYSNHGLAISPGMKKRIRMGQYEFPNPEWSDVSEEAKQLIRTLLKTEPTQRMTITEFMN
HPWINQSMEVPQTPLHTSRVLKEERDAWEEVKEEMTSALATMRVDYEQIKIKTIEDSTNP
LLTKRRKKANNTTQDPKSAAH
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgatatccaaagttaaaaaccagtttcaaaacccgggcgggcagcagaatcccacgggc
cagttcgtcccctttcacccgagacccaacctacagatcaagaagaacgccataacagac
gactacaaaataaccagccaggtgttgggactggggatcaatggcaaggtgctggaaatc
ttccagaagaataccgaggacaagtacgcgctaaagatgctacaggactgtcccaaggcc
cgcagggaagtggagcttcactggagggcgtcaccttgtgctaacatcgttcgcattgtt
gatgtttatgagaacctctatcagggcaggaagtgtctgctgattgtcatggagtgcatg
gatggtggtgagctttttagtcgaatccaggacagaggagaccaggccttcacagagaaa
gaggcatctgatattatgaagagtataggagaggccatacagtttttgcatgcgatcaac
attgcacacagagatgttaagccagagaatttgctgtattcttcgaagaggccaagtgct
ctcctcaaactcacagacttcggctttgccaaggaaaccacctcacacaattcgctaaac
actccctgctatacaccctactatgttgctccggaggttcttggcccagagaaatatgac
aagtcatgtgacatgtggtcgttgggtgtcattatgtatatcctgttgtgtgggtatcct
ccgttttattctaaccacggcctagccatctctcctgggatgaagaagaggatcaggatg
ggccagtatgaattccccaatcctgaatggtctgacgtatcagaagaagctaaacagctg
atcaggacacttctaaagaccgagccgacccaaaggatgaccatcacagagttcatgaat
catccatggatcaatcaatcaatggaggttcctcagaccccactccacaccagccgggtt
ttaaaggaggagagggatgcatgggaggaagtcaaggaggaaatgaccagtgccttggca
acaatgagagtcgactacgagcaaatcaaaatcaagaccattgaagactcgaccaatcca
ctgctaacaaaaagaaggaagaaagccaataataccacgcaagacccgaagtctgctgcc
cactga

DBGET integrated database retrieval system