KEGG   Austrofundulus limnaeus (annual killifish): 106514741Help
Entry
106514741         CDS       T06063                                 

Gene name
mars
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim00450  Selenocompound metabolism
alim00970  Aminoacyl-tRNA biosynthesis
alim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    106514741 (mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106514741 (mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:alim01007]
    106514741 (mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:alim03016]
    106514741 (mars)
Enzymes [BR:alim01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     106514741 (mars)
Amino acid related enzymes [BR:alim01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   106514741 (mars)
Transfer RNA biogenesis [BR:alim03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    106514741 (mars)
 Prokaryotic type
   Other AARSs
    106514741 (mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_N_3 GST_C_3 GST_N_2 GST_C_2 HTH_23 GST_C_6 GST_C GST_N_4
Motif
Other DBs
NCBI-GeneID: 106514741
NCBI-ProteinID: XP_013859608
UniProt: A0A2I4AVU1
Position
Unknown
AA seq 926 aa AA seqDB search
MKLFVSEGNPHCLKVLAALEVTGLQCGVQYVNHEEKVVPFLNRPSLPALLLPSGQYLFSS
SSICRYFFEANGQECNDLCNQWLEWEITVLQPALLQTLHMAVLQGKGSEVSRVLQSPLNV
LDQSLSKGTMPFLTGEAVSVADVVIWGALHPVLSDSSLALSEHVSVRAWFDRVAVMHSCQ
SAAQKVLQGKGLQAMKSYMQKQPAPQSSQCRDTQPCNSSPAENEEGERVVSEEEMEAAVL
TWRKSLNTSSPATDKQLPVLPKEDKRNVLVTSALPYVNNVPHLGNIIGCVLSGDVFSRYG
RLRGWNMLYVCGTDEYGTATENKAREEGLTPQQICDKYHMVHSSIYKWFQIDFDFFGRTT
TEKQTEIAQDIFWRLHKNQYLVEDTVEQLRCEKCQRFLADRFVEGTCPHCSYPEARGDQC
DKCGRLINAVELREPQCKVCRQTPVIRSSKHLFLDLPKLESQLEQWLDKSTSSGDWTANA
KQITRSWIRDGLKPRCITRDLKWGTPVPHPDFKEKVFYVWFDAPIGYLSITANYTKEWEK
WWKNPHQVELYNFMAKDNVPFHSVVFPCSLLGAQDNYTLVNHLIATEYLNYEDTKFSKSR
GVGVFGDMAKDTGIPSDVWRFYLLYVRPEGQDSAFSWADMALKNNSELLNNLGNFINRAG
MFVSRFFEGCVPVMDLQREDKKLLALVGWELQQYIQLLDKVRIRDALKHILNISRHGNQY
IQVNEPWKKIKGGELERRRAGTVTGVSVNISCLLSVMLLPYMPEVSQTIRDQLNAPQSCI
NTMLQGTGTFVCALSAGHRIGTVSPLFQKLEADQIEALKKRFGGQQPEEEPSNKKKPSEN
ITTAQPAAAAAPSDGVKPTAVVGVDPEKAKQLTKAVAEQGEKVRALKAQKAEKDVITAEV
SKLLDLKKQLALAEGKNPEPQKGKKK
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtttgtaagcgaaggcaacccgcattgcctgaaagtgttagctgcgctggaa
gtgacaggacttcagtgcggtgttcagtacgtcaaccacgaagaaaaagtggtgcctttc
cttaaccgtccatctttgccagccctgctcctgcccagtggacaatatcttttcagctcc
agttccatttgcagatacttttttgaagcaaatggacaagaatgcaacgatctctgtaac
cagtggcttgaatgggagatcacagttcttcagcctgcgttgttacagactcttcatatg
gcagtgctgcagggaaaaggttcagaggtgtccagggtccttcagagtcccctgaacgtt
ttagaccaaagtttgagcaaggggactatgccatttttaactggggaagctgtttcggtt
gctgatgttgttatttggggggcgctgcaccctgttttatctgactcctctttagctctg
agcgagcatgtgtctgttagggcttggtttgaccgtgtggctgttatgcacagctgtcag
tctgctgctcaaaaagtgcttcagggaaaaggcctgcaggccatgaagagctacatgcag
aagcaacctgcgccacagagcagccagtgcagagacacacagccatgcaacagcagccct
gctgagaatgaggaaggtgagcgtgttgtttcggaggaggagatggaagcagctgttctc
acctggaggaaaagcctaaacacttcttctccggcaacagacaaacaacttcccgttttg
ccaaaggaggacaagcgaaacgtccttgtgaccagcgctttgccgtatgtcaacaacgtt
ccccaccttggaaacatcattggctgtgttctcagtggtgatgtcttctccaggtatggc
cgtctgcgaggctggaacatgctgtatgtgtgtggcacagatgagtacggcacagctaca
gagaacaaagccagagaagaaggcctgacgcctcaacagatctgcgacaaataccacatg
gttcactccagcatctacaaatggttccagattgactttgactttttcggcagaaccacc
acagagaagcagaccgagatagcccaggatattttttggcgcctccacaagaaccagtac
cttgtagaagacacggtggagcaactacggtgtgaaaagtgtcagcgtttcctggctgac
cgcttcgtagaaggcacgtgtccccactgcagctatcccgaagctcgcggtgatcagtgc
gacaagtgcgggcgcctcattaatgcagtggagctcagggaacctcagtgtaaggtctgc
agacagactccagtaattcgctcctccaaacatcttttcctggacctaccaaagctcgaa
tctcagttggagcagtggctggataaatcaaccagctcaggagattggacggcaaacgcc
aaacagatcactcgttcctggataagagatgggctcaagcctcgctgcatcaccagggac
ctgaagtggggaacaccggtacctcaccctgacttcaaagagaaggtgttctatgtgtgg
tttgatgcccccattggttacttgtccattactgccaactacaccaaggaatgggagaag
tggtggaagaatcctcatcaggtggagctgtataacttcatggccaaagacaacgtgccg
ttccacagcgtagtgttcccctgctctctactgggagcacaggacaactacaccctggtc
aaccatctaattgccaccgaatatctgaattatgaggacacaaagttctccaagagccgt
ggtgtgggcgtgttcggtgacatggcgaaagacacgggcatcccctctgatgtgtggcgg
ttctatctcctgtatgtgcgtccagaagggcaagattcagctttctcgtgggctgacatg
gctctgaagaacaactctgagctgctcaacaacctgggaaacttcatcaaccgagccggg
atgtttgttagtaggttctttgagggatgtgtgcctgtgatggatctgcagcgggaagat
aaaaagcttctggctctggtgggctgggaactgcagcagtacatccagctgctggacaaa
gtcagaattcgtgatgccctgaaacacatcctgaacatttcccggcatggcaaccagtac
attcaggttaatgaaccctggaagaagatcaaaggtggagagctggaaaggcggcgtgcc
ggcaccgtgacgggcgtttctgtgaatatctcctgcttgctgtcagtgatgctcttacct
tatatgccagaggtcagccaaaccatcagggatcagctcaacgcccctcagtcttgtatc
aataccatgctgcaaggcaccggaacgtttgtgtgcgctctgagcgccggccaccgcatt
ggcaccgtcagtccgttatttcagaaactggaggctgaccagattgaagctttgaagaag
agatttggtggacagcagcctgaagaggagccatctaataagaagaaaccatcggagaac
atcaccactgctcaacctgctgctgcagccgctccctctgatggcgttaaaccaacggcg
gtggtcggagtggacccagagaaggccaagcagctcaccaaggctgtggctgagcagggg
gaaaaggtccgagcactgaaagcccagaaggcagagaaggacgtgatcacagcagaggtg
tccaaacttttggaccttaagaaacaactggctctcgctgaggggaagaaccctgaacct
cagaagggcaagaagaagtga

DBGET integrated database retrieval system