KEGG   Austrofundulus limnaeus (annual killifish): 106514812
Entry
106514812         CDS       T06063                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04080  Neuroactive ligand-receptor interaction
alim04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106514812 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106514812 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 106514812
NCBI-ProteinID: XP_013859707
UniProt: A0A2I4AW38
Position
Unknown
AA seq 75 aa
MNVKILTLVIVLLVSLLCSAGAGPMASTEHGRGLEETATVRKMAQQNPMRGGQTHRPAKR
RRPRPRLSHKGPMPF
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
ggtgctggtcccatggcctccacagagcatggcagagggctggaggagacagctacagtg
agaaaaatggcgcagcagaacccgatgagaggcggtcagacccacagaccggccaagaga
agacgcccacggccccgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system