KEGG   Austrofundulus limnaeus (annual killifish): 106516247Help
Entry
106516247         CDS       T06063                                 

Definition
(RefSeq) BDNF/NT-3 growth factors receptor-like
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106516247
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:alim01001]
    106516247
Enzymes [BR:alim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106516247
Protein kinases [BR:alim01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   106516247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 LRR_8 LRR_5 Ig_2 LRR_4 LSR Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 106516247
NCBI-ProteinID: XP_013861960
UniProt: A0A2I4B2H0
Position
Unknown
AA seq 790 aa AA seqDB search
MDSGAGGYHGMARFGFYALLMGLCWTLGHACPESCACSVSRIVCIDSEPGIEDFPVLTLD
DMENITEIYIANQNRLFDISDSSLRHYINLRNLTITKTRLTSISSDAFFNNTRLQYVDLR
DNNLSMLSWRTFQNFNISFPLLLSGNPLDCVCENLWIKLRLQEEMDSPELTCTEESGGTR
DFATLTPPDCVVPKVEVFPRSVTEMEGGNVKAVCSASGSPFPVIQWNPEMLSTKFVMDPS
DTKSSLILSGLSPDDNGKVVVCSAENMVGQNEATLMLNILFPPTIQNLMPPERDHHWCIP
FTVTGNPKPYLHWYHNNMLLQEQDFIRTMIHESTENEDHGCLQLVNPTHIHNGEYKLVAK
NKFGQDEKTVSAQFIDPPSGPDEEYDDTPLPPLDDSVAVYVVVGIAGVALTGCVLMVIIL
KYGRNSKFGIKGSSSVISNDDDSASPLHHVSNGNNTPSSSEMGPDAVIIGMTKIPVIENP
QYFRNSGSILKSDTFVHHIKRHNIVLKRELGEGAFGKVFLAECYNLVPDQEKIHVAVKTL
KEATESGRADFYREAELLTNLQHEHIVTFYGVCVESDPLIMVFEYMKHGDLNKFLRSHGP
DAVLMADGQHSILVELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKI
GDFGMSRDIYSTDYYRVGGHTMLPIRWMPPESIMYRRFTTESDVWSLGVVLWEIFTYGKQ
PWYQLSNNEVIECITQGRVLQRPRTCPKEVYDLMLGCWQREPYMRLNIKEIHSMLQSLAK
ASPVYLDILG
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggactccggcgcggggggataccatggcatggctcggttcggattctatgcgctcctg
atggggctgtgctggacgctcggccacgcgtgccccgaatcgtgcgcctgcagcgtctcg
cggattgtttgtatcgattccgagccggggatcgaggatttccccgtgctcacgctggac
gacatggaaaacatcaccgagatatacattgctaaccaaaacagactatttgacatcagt
gacagcagtctgaggcactacataaacctcagaaacctaacaatcacaaagacacgtctt
acgtccatttcatcggatgctttttttaacaacacgagacttcaatatgtagacctcaga
gacaacaacctttccatgttgtcatggagaacatttcagaactttaacatttcatttccg
cttcttctatctgggaaccccctggactgtgtttgtgagaacttgtggatcaaactgaga
ctccaagaagagatggacagtccagagctgacgtgcaccgaagagagtggagggacgagg
gactttgcaacgttaactccaccagactgtgtggttcccaaggtagaggtcttcccgagg
agtgtgactgaaatggagggtggtaatgtgaaagctgtgtgcagcgcctcgggctcccct
tttcctgtgatccagtggaatcctgaaatgctgtcaaccaaatttgtgatggatccctcg
gatacgaagagcagcctcatattgtcaggcctgtctccagatgataacggcaaggtggtc
gtgtgcagcgccgagaacatggttggtcagaacgaggccacgcttatgctcaatattctc
tttccccccaccatccagaacctgatgcccccagaacgggaccaccactggtgcatcccc
ttcaccgtgacaggaaaccccaagccctatctgcactggtaccacaacaacatgctgctg
caggagcaggacttcattcgcaccatgatccacgagtccacagagaatgaagaccacggc
tgcctgcagctagtcaaccccacacacattcacaacggcgagtacaaactggtggcaaag
aacaaattcggccaggatgagaagacggtcagcgcccagtttatcgatccgccttccggg
ccagatgaagagtatgatgacacaccactgcctccactggacgacagtgttgcagtgtat
gtagttgtgggaatagctggagttgccttgactggctgtgttttgatggtcatcattctg
aaatatggaagaaactcaaagtttggtatcaaaggctcctcctctgtaatcagcaatgac
gatgactccgctagccctcttcatcacgtctccaatggcaacaacaccccgtcgtcctca
gaaatgggtccagatgcggtgatcattggcatgacaaagattcctgtaattgagaacccg
cagtacttccgtaactccggcagcattctgaaatccgacacgtttgtccatcacatcaaa
agacacaacatagtgctgaagcgggagctgggagaaggagccttcgggaaagtgtttctt
gcagaatgctacaacctggtgccagaccaggagaagatccacgtggcggtcaagaccctg
aaggaggccaccgagagcggccgagcagacttctacagagaggctgagcttctcaccaac
ctgcagcacgaacacatcgtcaccttctacggggtgtgcgtggagagcgacccgctcatc
atggtgtttgaatacatgaagcacggcgacctgaacaagtttctcaggtctcacggtcct
gatgcggttctcatggcagacggtcagcacagtatcctagtggagctaacgcagtcccag
atgctgcacattgctcaacagattgctgctgggatggtctacctggcttcgcagcatttt
gtccacagagacttggcaacaaggaactgcctggtaggagaaaacctacttgtcaagatt
ggagactttggcatgtccagagacatttacagcacagattattacagagtgggcggtcac
acgatgctgcccattcgctggatgcccccggagagcatcatgtatcggaggttcaccaca
gagagcgacgtgtggagcctcggcgtggtgctgtgggagatcttcacctatggcaagcag
ccctggtaccagctctccaacaatgaggtgattgaatgcatcacgcagggccgagtgctg
cagcggccccgcacctgtcccaaggaggtgtatgacctgatgctgggctgctggcagagg
gagccctacatgaggctcaacatcaaggagatccacagcatgctccagagcctggccaag
gcctcacccgtctatctggacatactgggctga

DBGET integrated database retrieval system