KEGG   Austrofundulus limnaeus (annual killifish): 106516687
Entry
106516687         CDS       T06063                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Brite
KEGG Orthology (KO) [BR:alim00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:alim01002]
    106516687 (adamts13)
Enzymes [BR:alim01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     106516687 (adamts13)
Peptidases and inhibitors [BR:alim01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   106516687 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_spondin Reprolysin_4 Reprolysin_3 TSP1_CCN Reprolysin_5 ADAM_spacer1 Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 106516687
NCBI-ProteinID: XP_013862615
UniProt: A0A2I4B4F5
Position
Unknown
AA seq 1385 aa
MVFVAPLCLLLLLPGFSPLMGDPQNEKLDDLYVTPVDLISSGSSADTTGVLSSRLRRSAL
PPDISHLELMVVVGPDVQQVHKQDTDRYILTNLNIASELLRDVSLGANLRVHLVRMVILS
EPEPEIQMSSNIISSLRSVCDWGRRINPSNDTDPLHADLLLYITRFDLELPDGNRQVRGV
TQLGGVCSSDWSCVITEDTGFDLGITIAHELGHSFGINHDGFENSCSRSGFMMASDGGYN
SVDLTWSPCSRQQLLTFFSEGKAECVKDLPTLSGSLQDWKPGLYYGVDDQCRIAFGSTAR
ACSFTNPDLAACRVLSCHVEPDDDSSCKRLLVPLLDGTECAPDQWCLKGRCVSPHDFGSS
VVVNGSWSTWSEFSSCSRTCGGGVTLRTRQCNNPRPAFGGKDCEGPDIEAELCHQQPCEC
TQLDFMAEQCSQTNLYPLYLQSTTASFYKWIPALGFAKGDEQCRYMCQSDGENFIVSRGS
HFVDGTRCESESPLPFGATAACLQGRCQLFGCDGVLHSGKVQDVCGVCDGDGSTCSLTCG
SYSGGQAKEYSTFLTLPVNATQVHIVNMAPLFTHLAVMVGGQYIVSGTGSMALNVTHPSP
LDENHLEYRLHLTPDLLPEMEEVMAHGPLKKEINIQIYRKYGKEYGEKTNPNISYWFYVP
ARNRSSVDVIPDGKWAVFTTPCSVSCGSGVQKHVFVCVDKNTNSHLQEHHCKAPRPTAPL
HTTCQLTACPPRWDAGNFGACSTSCGGGVRVRPVRCVQKHRSDLVTVPESECSSDTAPHS
AEQCNLHHCPARWRVSEPGNCSAVCGPGEAKRDVSCVRQEDGQDNEVDQSLCSKWIKPDD
FVPCVVDVCPVGWESKGEGLPVLKPGLLPRSSQPHVYVWSPVVSQCSKTCGNGTLQVWFS
CVDHESRLGVPDFNCDASTKPDLQTEICGTSSCPAIWRSKQGICSVSCGGGVANLVQYCA
REVEGEEVVVDDSNCSNFPKPAAVVSCNTHNCPARWKVVKISPCSVSCDLGIAERNVSCV
QFIHGRESVVSEDRCRVVVKPATAVPCLVKVCTYRWEVKPWSQCSVPCGYGIQSRTVSCM
GPSKPEPLSPLFCIHMPKPITIQGCYRDSCRDVTTDSTAAKTNLTETPLPPPTLGHKDAP
HTGGTLPSPTVVVATQTSTAPTPTPKPSVCGQLLLEESGTVDLKDVKSRCTISIGRPLDE
VIHIKVLSSSLSCRKKEYVAFFDRLAFLRKCAQLSGSELTTRTNVVLVRQNLFTPGRGVV
FTYSSQKNVKRSHHQDCDIQLFSPSGVFENPLTSNANHTCRVLITAPPSVKIRIQALHIG
LVFNATNSQSTYIMIQDMDVLKTTVFNGQQLFLWHSSGNMAGVEFHGDYLHTKGTFRAEY
SFMPL
NT seq 4158 nt   +upstreamnt  +downstreamnt
atggttttcgtcgctccactgtgtctactgctcctgctgcctggcttcagtcctttaatg
ggagatccacagaatgagaagcttgatgatctctacgttaccccagtagatttgatctct
tcaggatcctctgctgacactacaggtgtgttaagcagtcgcctgcgtcgctccgctctg
ccccctgatatttctcacctggaactgatggtggtggtgggacctgatgtccagcaggtc
cacaagcaggacacagacagatacatcctcactaatctcaatattgcctctgagctgctg
agagacgtgtctctgggggccaacctgagggtgcacctggttcgcatggtcatcctgtcg
gaacctgaaccagagatccaaatgtcctccaacatcatatcttccctcagaagtgtgtgt
gactggggtcgaaggatcaacccctccaacgacacggatccgctgcatgccgatctcctg
ctgtatattacaaggtttgacctggagctgcctgatgggaacaggcaggtcagaggagta
acgcagctaggaggggtttgctctagtgattggagctgtgtgattacagaggacacaggc
tttgacctgggcatcaccattgctcacgaacttggccacagttttggaatcaaccacgat
ggatttgagaactcctgcagcaggagtggctttatgatggcctctgatggaggctacaat
agtgtggacctgacctggtccccctgcagcaggcagcagcttcttacgtttttcagtgaa
gggaaagcagagtgtgttaaagatttgcctacactgagtggctccctgcaggattggaaa
cctggcctgtattatggtgttgatgaccagtgtcgtatagcttttggcagcactgcgaga
gcctgctcctttaccaatcctgacttggcggcttgtcgtgttctatcctgtcacgttgaa
cctgacgatgacagttcctgcaaacgcctcctggttcctctgctggatgggacagagtgc
gctcctgatcagtggtgtctgaagggtcgctgtgtgtctccacatgattttggctcctct
gttgttgtcaacggctcctggtccacgtggtccgagttctcctcctgctcgcggacatgt
ggcggaggggtcacgctccgcacacgtcaatgcaacaacccaagacctgcttttggaggg
aaggactgtgaaggtccagatattgaggccgaactttgtcaccagcagccttgtgagtgc
acccagctggactttatggcagagcagtgttcccaaaccaatctctaccccctctacctt
caatcaaccaccgcctctttctacaaatggatccctgctcttggttttgcaaaaggggat
gagcagtgcagatatatgtgccagtcagatggagaaaacttcatagtgagccgtggctct
cactttgtggatgggactcgctgtgagtcagagagtcctcttccttttggcgcaacagct
gcttgtctgcaaggcagatgtcagctgtttggctgtgatggagtgctgcactctgggaaa
gtgcaggatgtttgcggggtgtgtgacggcgacgggtcgacctgcagtttaacatgcggc
tcctacagtggtggtcaggccaaagagtacagcactttcctcacactgccagtgaatgca
acacaggtccacatcgtcaacatggctcctctcttcactcatttggctgtgatggttggg
ggtcagtacatcgtgtcaggaacaggcagcatggctttgaatgtcacccatccctccccg
ctggatgaaaaccatctggagtaccgcctccacctgacccccgaccttttacctgagatg
gaagaggtgatggcgcatggacctctgaaaaaggagataaatatacagatctatcgcaaa
tatggaaaggagtacggtgaaaaaacaaatccaaacatcagctactggttttatgtacct
gccagaaacaggagctcggtagatgttatacctgacggcaaatgggctgttttcacaacg
ccatgctccgtctcttgtggatcaggtgtacagaagcacgtgtttgtctgtgtagacaaa
aataccaacagccatttgcaggagcatcactgtaaagcccctcgtccaactgcacccctc
cacacaacgtgtcagcttacagcctgtccccccaggtgggatgcaggaaatttcggagct
tgtagcacctcctgcggagggggagttcgggtgcgtcctgtacgatgtgttcaaaaacac
agatcagatttggtaacggttccagagtctgaatgttcctctgatactgcgccacactct
gctgaacagtgtaacctgcaccactgtcctgccagatggcgcgtgtcagagccagggaac
tgttctgcggtgtgtgggccaggagaggcgaaacgcgatgtgtcgtgtgttcggcaggaa
gatggtcaggacaatgaagtggatcaaagcttgtgttcgaagtggatcaaaccagatgat
tttgtgccatgtgtggtagacgtctgcccagttgggtgggaatctaagggggagggcctg
cctgtcttgaagcccggtttgttaccacgctccagtcagcctcatgtgtacgtgtggagt
cctgttgtcagccagtgttcaaagacttgtggcaacggaaccctgcaggtgtggttttcc
tgtgtggatcatgagagcagacttggggttcctgactttaactgtgacgcttctaccaaa
cctgatcttcagacggagatctgtggcacttcttcatgccctgcaatatggcgctctaag
caaggaatctgcagcgtgtcatgtggaggaggggtggcaaacctggtgcagtactgtgcc
agagaggtagagggagaggaggtagtggtggatgactccaactgcagcaactttcccaaa
cccgccgccgtggtttcctgcaatactcacaactgccctgcaagatggaaggttgtcaag
atatcaccctgctctgtctcctgtgacctgggcatagctgagaggaatgtgtcctgtgtc
cagtttatccacggcagggagagcgtggtgtcggaggatcgctgccgtgtggttgtcaaa
ccagccaccgccgtaccctgcctggtgaaagtctgcacctacaggtgggaggtgaagccg
tggagccagtgttcagtaccctgtggatatggtatccagtcaagaaccgtctcctgcatg
ggcccctccaagccagagcccctcagccccctgttttgtatacacatgcctaaaccaatc
accattcagggctgctacagagacagctgcagagatgtgaccactgacagcaccgctgca
aaaacaaacctcacagagaccccgctcccacctccaactctgggccataaagatgcacca
catacgggcggcactcttccaagcccaacagtggtcgtagccactcaaacgagcaccgct
cctaccccgacccctaaacccagtgtttgcggacagctccttctggaagaatcaggcacc
gtagatttgaaagacgtaaagagccgatgcaccatatccattggtcgaccgctcgatgag
gtcatccacattaaagtcctatccagctccttgagctgcagaaaaaaggagtatgtggcg
ttcttcgatcgtcttgctttcctgaggaaatgtgcacagctatcgggtagcgagctcacc
accagaaccaatgttgtgcttgtgcgacagaatctgttcactcctgggagaggggttgtg
tttacctacagttcacagaagaacgtgaagaggagccaccatcaggattgcgacattcag
ctattttcccccagcggcgtttttgagaatccgttaacatcgaacgctaaccacacctgc
cgagtgctcatcaccgcccctccctcggtgaagatcagaatccaagctctgcacatagga
ttagtattcaacgcaaccaactcacagtctacatacatcatgattcaggatatggatgtc
ttaaagaccactgtgtttaacggccagcagctgttcttgtggcactcctctggaaacatg
gctggggtggaatttcacggcgactacctgcacaccaaaggcaccttcagagctgaatat
tcttttatgcctctttga

DBGET integrated database retrieval system