KEGG   Austrofundulus limnaeus (annual killifish): 106517147Help
Entry
106517147         CDS       T06063                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04020  Calcium signaling pathway
alim04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    106517147
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106517147
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:alim04030]
    106517147
G protein-coupled receptors [BR:alim04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    106517147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 106517147
NCBI-ProteinID: XP_013863315
UniProt: A0A2I4B6F2
Position
Unknown
AA seq 351 aa AA seqDB search
MDNISLEWTREANTSLQTEMSCATLRNQVSHIFLYTFLSAGIVSTVVGNFLVVLSIAYFK
QLQSPTNCFVMSLAVADCLVGLLVMPYSMIRTVEGCWYFGSLFCKLHSSLDVMLCTASIF
HLSCIAFDRYYAVCNPLVYSLKMSPNRVALLIAVCWAVPMLISFGPIMLDLHIADIDIPI
PEDMCVFLVSRIYAVMASLVAFYLPMAVMLVAYWKIFKAAKRQAQQINAMESQMAAGVGK
DSSKKKRHRNTMKREGKAAKTLGIIMGVFLIFWMPFFTINIMDPFINYSTEVVVWDVFLW
LGYINSSLNPFLYVYFNRCFRRAFLMFIGCKVCLPGISPGMELSHSKKEAN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggataacatcagcctggaatggactagagaagctaacacatctcttcagacagaaatg
tcctgtgctacattgaggaaccaagtgtcacacatttttctgtacaccttcctctcagct
ggcatagtgtccactgtggtgggcaacttcctggttgttttgtccatcgcctacttcaag
cagctgcagtctccgacaaattgttttgtcatgtcccttgccgtggctgactgcctggtt
ggcctgttggtgatgccttacagtatgatccgaactgtggagggatgctggtactttggc
tccctgttttgcaagcttcactccagcctggatgtcatgctctgcactgcctccatattc
cacctcagctgcattgcctttgaccggtattatgccgtttgcaatccgctggtttactcc
ttgaagatgtcccccaatcgagtagctctgctcattgctgtttgttgggctgtacctatg
ctcatctcctttggtcccataatgctagaccttcacattgctgacatagacataccaatt
cctgaagacatgtgtgtatttttggtcagtcgcatttacgccgtcatggcctcattagta
gccttttacttgcccatggctgtcatgctcgtggcctactggaagatcttcaaagctgcg
aaacggcaggcccagcagatcaacgccatggaaagtcaaatggctgctggagtgggcaaa
gactcgagcaagaagaaacgacaccgcaacactatgaagagggaaggcaaggcagcaaaa
actttaggcattatcatgggagttttccttatcttctggatgcccttttttacaatcaac
attatggatccgttcatcaattatagcactgaggttgttgtctgggatgttttcctgtgg
ttaggatacatcaattcatcacttaatcccttcttgtatgtttattttaaccgctgcttt
cgaagagcattcctcatgttcattggctgcaaggtgtgcctgcctggaatatctcctggg
atggagttatcacattctaagaaagaggcaaactaa

DBGET integrated database retrieval system