KEGG   Austrofundulus limnaeus (annual killifish): 106519610Help
Entry
106519610         CDS       T06063                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit-like
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04260  Cardiac muscle contraction
alim04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106519610
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106519610
   04261 Adrenergic signaling in cardiomyocytes
    106519610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:alim04040]
    106519610
Ion channels [BR:alim04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106519610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Serinc DUF202
Motif
Other DBs
NCBI-GeneID: 106519610
NCBI-ProteinID: XP_013866811
UniProt: A0A2I4BGE7
Position
Unknown
AA seq 361 aa AA seqDB search
MSSFSTRALTLLSSVFGACGLLLVGVAVSTDYWLLMEEGIVLQQNQTTEVKMALHSGLWR
VCFVAGPEKGRCVASEYFTEPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPREPEQFFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFMKRYAEEELYRPHPALYRPRXSDCSNYSGQFLHPDSWAPP
QRGRSASDVSSDISIQLNQTPPPQQXCKGGSSSQATPSSSGPSSAASYQLQPASSSSTSS
SYPHPLHPGATATLTRVPHAHPHSQPHPHPSGPPSQSLPMAAPPAAVPPPRYHTRMSASP
C
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgttcagtactcgggctctgacgctgctctcctcagttttcggggcctgcggt
ttgctgttggtcggcgtggccgtgtccacggattactggctgctcatggaggaagggatc
gtcctgcagcagaaccagaccactgaggtcaagatggcgctgcattccggcctgtggaga
gtctgctttgtggcaggacctgagaagggcagatgtgtggcgtcagagtatttcactgaa
ccagagatagagatcacgactgaaaacacagccaacatcctcaaaatggtccgaactgcc
acgccgttccccatggtctccctgctgttcgttttcaccgccttcgtcatcagcaacatc
ggtcacatccggcctcagcgcaccatccttgccttcgtatccgggatcttcttcatcctc
tcaggtctgagtctggtggtgggtttggttttatacatctccagtataaatgatgaagtg
atgaatcgacccagagagcccgagcagttcttccactaccgctacggctggtccttcgcc
ttcgctgcctcctccttcctgctaaaagagggtgcaggtgtaatgtcggtctacctcttc
atgaagcgttacgcagaggaggagctttaccgcccccaccctgcgctctaccgcccccgc
aygtccgactgcagcaactacagcggccaattccttcacccggactcctgggctccacct
cagaggggccgaagtgcctccgacgtctcgtctgacatttccatccagctcaaccagacc
ccgcctccgcagcagscctgtaaggggggcagcagctcccaggcgacgccctcctcctct
gggccttcgtcagctgcyagctaccagctccagcctgcgtcttcctcctctacctcctcc
tcctatccacacccgcttcatccgggggccacagccaccctaaccagggtcccccacgcc
cacccccactcgcagccccatccccatccgagcggacccccatctcagtccttgccgatg
gcagcaccacccgctgctgtgcctccyccacgctaccacacacgaatgagcgcctcgcca
tgctag

DBGET integrated database retrieval system