KEGG   Austrofundulus limnaeus (annual killifish): 106519665Help
Entry
106519665         CDS       T06063                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04260  Cardiac muscle contraction
alim04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106519665
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106519665
   04261 Adrenergic signaling in cardiomyocytes
    106519665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:alim04040]
    106519665
Ion channels [BR:alim04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106519665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 106519665
NCBI-ProteinID: XP_013866879
UniProt: A0A2I4BGJ8
Position
Unknown
AA seq 332 aa AA seqDB search
MRVCNRGVMMLLTTAGAFCAFSLMTIAVGTDYWLYSRGVCRSKNLNDNETVHKNEEVLTH
SGLWRTCCTEGIFRGVCKHIDHFPDDADYEQDAAEYLLRAVRASSLFPILSVGLLFLGGL
CVAASEFYKSRHNVILSAGILFVSAGLSNIIGIIVYISANSGDPSQSDNKKSYSYGWSFY
FGALSFVLAEMVGVLAVHVFIEKHRQLRTKGRPSLIKPPISRNSSYYRNRYYQNRSSRYS
YRSNHSTADSEAHTYPGPLGCDQELSVQSKMADMTGLPPTATVXSDFMLYTLTSPLKDSD
IMAVNDHATVAAHNNVEMLPGNCASSRRTTPV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagggtctgtaacaggggggtgatgatgctcctcaccacggcgggggccttctgcgcc
ttcagcctcatgaccattgcggtgggcaccgactactggctgtactcccgcggggtgtgc
cgctccaagaacctgaacgacaacgagacggtccacaagaacgaggaggtcctgacccac
tccggcctatggaggacctgctgcaccgagggaatattccgaggggtttgcaaacacatc
gatcatttcccagatgatgcagactatgagcaggatgctgctgagtatttactgcgagca
gttcgagcctccagcctgttcccaatcctcagtgtgggattgctgttcctcggaggactg
tgtgtggctgccagtgagttctacaagtcccgccacaatgtcatcctcagcgctggtatt
ctttttgtttctgcaggtctcagcaacattatcggcatcatcgtgtacatatcagccaac
tcaggtgaccccagccagagcgacaacaagaagagctactcctacggctggtccttttat
ttcggagccctgtccttcgtgctggctgagatggtgggtgtcttggcagtgcacgtgttc
atagaaaaacacaggcagctgcgcaccaaaggccggccttcgctcatcaagcctcccatc
tccagaaactcgtcctattaccgcaaccgttactaccagaaccgcagcagccgctacagc
tacaggagcaatcacagcacggcggactcagaagcgcacacctatccaggtcctttgggg
tgtgaccaggagctctccgttcagtctaaaatggctgacatgacaggtttacccccgaca
gccaccgtgrgctccgatttcatgctgtacaccctaacgtcgcctctcaaagacagtgat
attatggctgtgaatgatcacgcractgtagcggctcacaacaatgtagagatgctgcca
ggaaactgtgcatccagccgaaggaccactccagtctga

DBGET integrated database retrieval system