KEGG   Austrofundulus limnaeus (annual killifish): 106519846
Entry
106519846         CDS       T06063                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
alim  Austrofundulus limnaeus (annual killifish)
Brite
KEGG Orthology (KO) [BR:alim00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:alim03021]
    106519846 (aff3)
Transcription machinery [BR:alim03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     106519846 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 106519846
NCBI-ProteinID: XP_013867135
UniProt: A0A2I4BHB2
Position
Unknown
AA seq 1217 aa
MPTIVGGKGKLSVVCCLLRCAHSQVTRSQHNCCAKGILEDMTQSWPSQQAFGGDQRILYN
YKDGKQSAAHQRQSQGEAPQRVVHRHPCVAPHKSMLADDLKLSSDDEDTQRTIHESXSWD
RHSLSTQRAHTYGRRVRHSSSDSSDSDSTAKSSSSSTQSRSSSRSPELDPPSPANAQAPC
NNKETDHASATQWQLDKWLKKSKKKPGSTDQNHSQSHSDHQLSPKTQRAPSPARSWDSNQ
EYSPSQSPIPSPQFNYNHSSPVPSPGYSYCPSPSPFTSTCPSPSPSPRHNLIPSPAPSIC
PSPCGSPRVSRSPSPISKDPPKSPSPTLRGPSRVHRYLEGQSQNQAHSTLTSTSHGTKIR
PWIAPLPTNLKSKTASAIQHHPSHQHGPRTDPTQIQVQSQSKLKAHGALTSKQNLKSTPE
PSSHSSVKPLSDAPRAKNTLHFDQAQGNQPIHKLRNPFQSHSPSKSKHPVPFRRETRTVN
SSQSQSICKATSTSGTGSSARPSPNLIHWTKLWKARPSNPVHTNNSQNAQKKLQTKAQEV
DQRRFHLTQIEERKAERKEDRHHHEKQPGKPERKEDRRLAEEQLLRRPWIQNLAAEEEEE
GARDRQSGRKETERGKNRRKGEQLNKWPTAQAKEKGLTSIEQHRLPZDSDYQGRTKKGER
CEEDKDFSPRLASHSPTPQKTSSSSSSSSSSSPSNSGSESEYQPRTEKVSADSTSHKRLT
KKGHQAPGRPDASRPKVIHAKELNSRHPCEGSQTVGRQKLYTLVPFGRSEKAAPTSQRGL
RNLVVHIDLCLLKRVPESTTNSAKKPSSSSSPSVTKDKQRDAMKHVQVPETLTKDGKRKR
KLENGALDRECKKSLVYPNDTSGQTESSSLTAENLVTEMTHNGYLEEYLDNKRPLSPLSP
LSPLPQSPEITKPSTKAKAAEHVRTQKSKDKNKGQAVKPKMEVECVKVSRQPQPSSESSW
RPTSHGGTGPNHEISHHAEYYLHEAKRMKHRADAMVDKLGKAVNYVDAALSFMECGKAME
EGPLEAKSPYTMYSETVELIRYAMRLKSHSGPGARQEEKQLAVLCFRCLALLYWQMFRLK
KDHALKYSKVLLDYFKSSSKVPITPPGWNDSGKGMRESSLSPNAKHHRRDSYGSSASLIS
IPQRIHQMAANHLSITNSVLFSYEHWEVADNLAKENKEFFNYLNTLSGPLTLHSSVAHAV
QYTRQALQWIRISAKLN
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgcctactatcgtcggtggcaaagggaaactttccgttgtctgctgtttgctccgatgc
gcacattctcaggtaacaagaagtcaacacaactgctgtgccaaaggcattcttgaggac
atgactcagtcctggccgtcccagcaggccttcgggggtgaccagcgaatcctctacaac
tacaaggatggaaagcagtcagctgcacaccaaagacaaagtcagggggaggcaccgcag
cgagtggtccaccggcacccttgtgtggcgcctcacaaatcgatgctggctgacgaccta
aagctgagcagtgatgatgaggacactcagaggaccattcacgagtcgrcttcctgggac
agacacagcctgtcaacgcagcgagcgcacacatatggcaggcgggtgagacattccagc
tcggactcatcagactcagactccacagccaagtcgagcagcagcagtactcagtctcgc
agttccagccgaagtccagaactagatcctccatcacctgccaacgcacaggcgccatgc
aacaacaaggagacagatcatgcctctgctacccagtggcaattagataaatggctgaag
aaatccaagaaaaaacctggcagcactgatcaaaatcactcacaaagtcattcagaccac
cagctttctcccaagacccagagagccccgtcgccagccaggtcctgggacagcaatcag
gagtacagccctagccaaagtcccatacccagcccacagttcaattacaaccacagcagc
cctgtacccagccctggttacagttactgtcctagccccagtccattcaccagtacctgt
ccaagtccttccccaagtccaaggcataacctcattccaagtccagctccaagtatttgt
cccagtccatgcgggagtccacgagtcagccgaagcccaagtcctatatctaaagatcct
ccaaaaagcccaagtcccactttacgtggcccctcaagggttcatcgctatcttgaaggt
caaagtcagaaccaagcacattccactttaacatcaacttcccacgggacaaaaattaga
ccatggattgctccgttacctaccaatttgaagagtaagactgcaagtgccattcagcat
cacccatctcatcagcacgggcccaggactgaccctacacagatccaagtccaaagccaa
agcaagctgaaagctcatggagctttgacttcaaagcaaaatctcaaatctacaccagag
ccttcctcacattcaagcgttaaaccgctttctgatgcacccagagctaaaaacacatta
cattttgatcaagctcaaggtaaccaacccatccacaagctacggaatccatttcagtca
catagtcccagcaaatcaaaacacccagtacccttccgtcgtgaaaccagaactgttaac
agttcccagtcccaatctatctgtaaagctactagcacttctggtactgggtcaagtgct
aggcccagccctaacctaatacattggacaaagttgtggaaggctagaccgtcaaatcct
gtgcacacaaataattcccaaaatgctcaaaagaagcttcaaaccaaggcacaagaagtg
gaccagagaagattccatttgactcaaatagaggagcgaaaagccgagagaaaagaggac
agacatcatcacgaaaaacaaccaggaaaaccagaaagaaaagaagacaggaggctggcg
gaggagcagctactaagacgtccctggatccaaaatttggctgcagaagaagaggaggag
ggagcgagagatcggcagagtgggagaaaagagacagaaagagggaaaaacaggaggaaa
ggggagcagctgaataaatggccaacagctcaagccaaagagaaaggtctgaccagcatc
gaacaacaccgccttccasaagattcagactatcaggggaggacaaaaaagggagagaga
tgtgaggaggacaaagacttttcaccccgtctagcttcacattctccaactcctcaaaaa
acatcctcctcatcctcgtcctcatcttccagctctccctcgaattcaggctcagaatct
gaatatcagcctcggactgaaaaagtttcagcagactctacctctcacaagagacttacc
aagaaaggacaccaagcaccgggcagacccgatgcctccaggcccaaggtgattcacgcc
aaagaactaaactctagacatccttgtgagggatcgcaaaccgtggggaggcaaaagctc
tacaccctcgtcccatttggacgaagtgagaaggcggctcccacttcccagcgaggctta
agaaatttggtggtgcacatagacctctgtcttctcaagagagtccctgagagcacgaca
aattctgctaaaaaaccctcctcttcatcatctccttcagtgaccaaggacaagcaaaga
gacgcaatgaaacacgttcaagtccctgagactttgacaaaagatggcaaaaggaaacgc
aagttggagaatggtgcactggacagagaatgcaagaagagcctagtttatccaaatgac
acctcaggacagacagaatcttcatctcttacagctgaaaacctcgtaactgagatgaca
cacaatgggtatctggaggagtacttggacaacaagcggccactgtctcccttgtctccc
ttgtctccgctgccccagagccctgagatcaccaagccctccaccaaagcaaaggcagct
gagcatgtccgtactcagaaaagcaaagacaaaaacaaaggtcaagccgtgaagccaaag
atggaggtggagtgtgtgaaagtatcaaggcagcctcagccatcatctgagtcttcctgg
agacctacttctcatggaggaactgggccaaatcatgaaatatctcatcatgctgagtac
tacttacatgaagctaaaaggatgaagcaccgggctgatgcaatggtggacaagttggga
aaagctgtaaactacgttgacgctgctctgtcctttatggaatgtgggaaggccatggag
gaaggaccacttgaggccaagtctccatacactatgtattctgagacagtggagctgatc
aggtatgcaatgagactcaaaagccattctggcccgggagcgagacaagaagagaagcag
ctggcagttctgtgtttcagatgcctcgctctcctttactggcagatgttccgcttaaag
aaggatcacgcgctgaagtactccaaagtactgcttgattactttaagagttcttccaaa
gtgcctataaccccacctggttggaatgactctgggaagggtatgagagaatcttccctc
tcacccaatgcaaaacaccacagaagggattcctatggtagctctgcatctctcataagc
atcccacaacgtatccaccagatggcagcaaatcacctgagcattaccaacagtgtcttg
ttcagctatgagcactgggaggtggcagacaatcttgcaaaggaaaataaagagttcttc
aactacttgaatactttgtctgggcctttgactcttcacagcagtgttgctcacgctgtc
caatacaccagacaggctcttcagtggatacgcattagtgccaaactgaactaa

DBGET integrated database retrieval system