KEGG   Austrofundulus limnaeus (annual killifish): 106519875
Entry
106519875         CDS       T06063                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Brite
KEGG Orthology (KO) [BR:alim00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:alim01002]
    106519875
Enzymes [BR:alim01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     106519875
Peptidases and inhibitors [BR:alim01002]
 Metallo peptidases
  Family M1
   106519875
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N ING
Other DBs
NCBI-GeneID: 106519875
NCBI-ProteinID: XP_013867175
UniProt: A0A2I4BHF4
Position
Unknown
AA seq 938 aa
MFPLLLVLSVLCPPSPGAQIPSQAQAKDPPIATNGQPFPWHRMRLPQTASPLHYDLTLHP
NLTTLDFTGVVRISLDVHEDTHTVILHAKQMQVSNVLLLAPDGARPLKVLEYPPFHQLAL
LSDSVLTKGRKYEVQLEFAANLSDSFHGFYKSSYRTSSGEVRVLASTQFEATFARGAFPC
FDEPAFKANFTIRITREPRHIAISNMPKVKTVDLPDGLLEDHFDTTVKMSTYLVAYIVSD
FLSVSRTTQHGVEISIYSVPEKINQTAFALDAAVKLLDFYDDYFDIPYPLPKQDLAAIPD
FQSGAMENWGLTTYRETALLFDPDKSSASDKLAITKVIAHELAHQWFGNLVTMEWWNDLW
LNEGFAKFMEFISLDLTYPELHVDDFFLGKCFEAMEVDSLSSSHPVSTPVENPTQIQEMF
DDVSYDKGACILNMLRDFLTPEAFEIGIIRYLKRYSYQNTVNSHLWESLTDICSSDDLDE
GRMKHVEFCSKRKLQSGTTKWYSGDELDVKTIMDTWTLQEGFPLVTVEVRGREVRLSQER
FLRAXDPSLTEGFLWQIPLTYQTSASNTVHRFLLKTKTDVLYLPEEVDWLKFNVNMSGYY
MVHYAGQGWDSIIKLLHHNHTALSGNDRASLIQNVFQLVGVGKVRLDTALELSLYLSRET
EIMAVTQGFGELVPLYKLMEKRDMPELENRMKGYIVDLFRDLIDQQEWSDSGSVSQRVLR
SYLLLFACIRNYPPCLKKATQLFNQWKDSDGTMSLPVDITMAVFVIGAXTPEGWDFLFEK
YRSSMQMSVKSRMKXAMTVTPLQDKLMWIMEQSLNGEVMKTQDLPDVVVSVAKNPRGYKL
AWDFLRANWVTMIKKFDLGSNIVSYMVTGVTNQYSTREMLNEIRSFFDALTEETGSKMRC
IQQTYETIEDNIRWMDSHLPLLEAWLNKRRHRTTHEDL
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgttccccctcctgttggtgctttctgttctctgtcctccctcacctggagctcagatc
ccaagccaggctcaagccaaggacccccccatcgccaccaatggtcagccttttccctgg
caccgaatgaggcttccccaaactgccagccccctgcactacgacctgaccctccacccg
aacctcacyaccctggacttcaccggtgttgttcggatcagcctggacgtgcacgaagac
acccacacggtgattctccacgccaagcagatgcaggtttccaatgtgctgctcctggct
cctgatggcgccaggcccctgaaggtgttggagtatcctcctttccatcagctggccctg
ctgtcggactccgtgctgaccaaaggcaggaagtatgaggtccagctggagtttgctgca
aacttgtccgacagctttcatggtttttacaaaagcagctatcgcaccagcagcggggag
gtccgggttctggcatctacgcagtttgaggcaacgtttgctcgtggagccttcccctgt
tttgacgagcccgcctttaaagccaacttcaccatacggattacacgagagccacgccac
atcgccatttccaacatgcccaaggttaaaacagtggatctgcccgacggtttactcgag
gatcactttgacacgaccgtaaaaatgagcacttacctggtggcctacatcgtgtcagac
ttcctgtctgtgagcaggaccacgcagcacggagttgagatctccatttattcagtgcct
gagaagatcaaccagacggcctttgctttggatgctgcagtcaagttgttggacttctat
gatgattattttgatatcccttacccgcttcccaaacaggacctggcagccatccccgac
ttccagtctggtgcgatggagaactggggtctgaccacctacagagagaccgccctcctc
tttgaccccgacaagtcctctgcctccgacaaactggccatcactaaggtcatcgctcac
gagctcgctcaccagtggtttggaaacctggtgacgatggagtggtggaacgacttgtgg
ctcaacgagggttttgccaagtttatggagtttatttcccttgacctgacgtaccctgag
ctgcatgtggatgacttcttcttgggcaaatgtttcgaggctatggaggtcgattctctc
agctcatcccacccggtctccaccccggtggaaaaccccacacagatccaggagatgttc
gacgacgtgtcatacgacaagggagcgtgcatcctgaacatgcttcgggacttcctcact
cctgaggcctttgagatcggcatcatccgatacctgaagcgctacagctaccagaacaca
gtgaacagccacctgtgggagagcctgactgatatctgcagctctgatgatttggatgaa
ggtcgaatgaaacacgtggaattttgctccaaacgtaaacttcagtctggaaccactaag
tggtactctggtgatgagctggacgtcaagaccatcatggacacctggacgctgcaggag
ggcttcccgctggtcactgtggaggtcagaggtcgggaggtcaggctcagtcaggagcgt
ttcctgagggccgamgacccctcccttactgaaggattcctgtggcagatcccactgaca
taccagaccagtgcatccaacaccgtccaccgtttcctcctcaaaacaaaaactgatgtc
ctgtacctgccagaggaggtggactggctgaagtttaatgtaaacatgagtggttactac
atggtgcactatgcaggccagggctgggattctatcattaaactgctgcatcacaaccac
acggctctgtctggtaatgacagagccagcctcatccagaacgtcttccagctggtcggt
gttgggaaggtgaggttggatacggccctggagctgtccctctacctgtccagagagact
gagatcatggctgtgactcagggcttcggagaactcgttcctctttacaagctgatggag
aagagagacatgcctgagctggagaaccgaatgaaaggttacatcgtggatctgttccgg
gatctgatcgatcagcaggagtggagcgactctggttccgtgtctcagcgggtgttgagg
agttacctgctgctgttcgcctgcatcagaaactaccctccctgtttgaagaaagccact
cagctgtttaaccagtggaaagattctgacggcaccatgagcctccctgtggatatcaca
atggctgtgtttgtgatcggagcccrcacaccagaaggatgggacttcctgtttgagaag
taccgcagctcaatgcagatgtccgtcaagagccgcatgaagayagccatgaccgtcacc
ccgctgcaggacaagctgatgtggataatggagcagagtcttaacggtgaagtgatgaag
actcaggacctccctgacgtggtcgtgtctgtagccaagaaccctcgtggctacaaactg
gcctgggacttcctccgagccaactgggtcaccatgatcaagaagtttgacctcggctcc
aacattgtgtcctacatggtgactggtgtgaccaaccagtactccaccagagagatgctg
aatgagattcggagcttcttcgatgctctgactgaagagaccggctcaaagatgaggtgc
atccagcagacctacgaaaccatcgaggataacatccgctggatggacagccaccttcct
ctgytggaggcttggctgaacaaacgcagacacagaacgactcacgaggacttatag

DBGET integrated database retrieval system