KEGG   Austrofundulus limnaeus (annual killifish): 106523638Help
Entry
106523638         CDS       T06063                                 

Gene name
asb13
Definition
(RefSeq) ankyrin repeat and SOCS box protein 13 isoform X1
  KO
K10335  ankyrin repeat and SOCS box protein 13
Organism
alim  Austrofundulus limnaeus (annual killifish)
Brite
KEGG Orthology (KO) [BR:alim00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:alim04121]
    106523638 (asb13)
Ubiquitin system [BR:alim04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     106523638 (asb13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3 SOCS_box
Motif
Other DBs
NCBI-GeneID: 106523638
NCBI-ProteinID: XP_013872585
UniProt: A0A2I4BXW4
Position
Unknown
AA seq 289 aa AA seqDB search
MEITRTRPSLYGEIAHGLGFWTDRSAVHEAAAQGRALQLQQLIQAGAAVNIVAVDSITPL
HEACIQGQTQCVRLLLDAGAQVDARNIDGSTPLCDACAAGSLDCVKLLLEYGATVNPPLF
TFSPLHEACMGGNSDCVQLMINRGAFMEAHDCHYGTPLHVACARQHYDCAKVLLIAGANV
NAAKLHETALHHAAKVKNTGLIELLVEFGGNVFARDNLNKKPIHYTSVGSASYLCLEFFE
NTPLSLQQLSRVALRRTLGSRAHGVISKLGLPTRIINFLSYVPPPVIEI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagatcacgcgaaccagaccgtccctgtacggagaaatcgctcatggccttggattc
tggacagaccggtcagcggtccatgaggctgctgctcagggcagagccctccagctgcag
cagctgatccaagcaggggccgctgtcaacatcgtggctgtggactccatcaccccgctg
cacgaggcgtgtattcagggtcagacccagtgtgtcagactgctgctggacgctggtgcg
caggtggatgctcgtaacatcgacggcagcactccgctgtgtgatgcctgtgcagctggg
agcctggattgtgtcaaactgctgttggagtatggtgcaactgtcaaccctccactgttt
accttctcccctcttcatgaggcctgcatgggaggtaattcagactgtgttcagctgatg
atcaatagaggagctttcatggaagctcatgactgtcactacggcacaccgcttcacgtg
gcctgcgctcgacagcattacgactgcgccaaagtcctcctcattgcaggggcaaatgtg
aacgctgccaagctccacgagacggctcttcaccacgcagctaaagtgaagaacacaggt
ctgatagagcttcttgtggagtttgggggcaacgtcttcgctagagataacctcaacaag
aaacccatccactacaccagcgtgggctctgcctcttacctctgcctggagttctttgaa
aacactcctctcagtctgcagcagctcagcagagtggctttgaggaggactctcggttca
agagcacacggagtcatttccaagctgggcttgcccacacgcatcataaactttctctcg
tacgttccacctcctgttattgaaatataa

DBGET integrated database retrieval system