KEGG   Austrofundulus limnaeus (annual killifish): 106528779
Entry
106528779         CDS       T06063                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim00230  Purine metabolism
alim00240  Pyrimidine metabolism
alim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alim00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106528779
   00240 Pyrimidine metabolism
    106528779
Enzymes [BR:alim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     106528779
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 AAA_17
Other DBs
NCBI-GeneID: 106528779
NCBI-ProteinID: XP_013879484
UniProt: A0A2I4CHM0
Position
Unknown
AA seq 262 aa
MATPPKKTRGAPGNFPRRHKKISIEGNIAAGKSTFVRLLQETSEDWEVIPEPIGKWCNVQ
TDTHNLYQELSSSQKSGGNLLQMLYNKPSRWSYTFQTYACLSRIRAQLQAPSAKLQEAEN
PVQFYERSVYSDRYVFASNLFESGDLTETEWSVYQDWHTWLLNQFESDITLNGIIYLRAP
PQRCMQRLLHRGREEEQGIPLEYLEQLHFKHESWLYHKNLRLDFTYLNELPVLVLDVEED
FNKDRIKQEVLINKVREFLTLL
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcgacaccaccgaagaagacacgcggagccccgggaaactttccccgccgtcacaag
aagatctccatcgagggaaacatcgctgcaggtaaatccacctttgtgcgcctcctccag
gagacctccgaggactgggaggtcatccctgaacccatcggcaagtggtgcaacgtccag
acagacacacacaacctttaccaggaactgagctcttctcagaagagtggaggaaacctg
ctgcagatgttgtacaataaacccagtcgctggtcctacactttccagacttatgcgtgc
ctcagcagaattcgagctcagcttcaggctccatctgccaaacttcaagaggcagaaaac
ccagttcagttctacgagcgctccgtctactcagacaggtatgtgtttgcatccaacctg
tttgagagcggtgacctgactgagacagagtggagtgtttatcaggactggcacacctgg
ttactgaaccagtttgaatctgacataaccctcaatggcatcatctacctgagagcgcct
ccacagcgctgcatgcaaagattgctgcaccgcggccgtgaagaggagcaggggattcct
ttggagtatctggagcagcttcacttcaaacatgagtcctggctctaccacaagaacctc
aggttggactttacgtacctgaatgaacttcctgttttagttctggatgttgaagaggac
ttcaacaaggatcgaatcaagcaggaagttctcatcaacaaggttcgagagtttctcact
ttgttgtga

DBGET integrated database retrieval system