KEGG   Austrofundulus limnaeus (annual killifish): 106530599Help
Entry
106530599         CDS       T06063                                 

Definition
(RefSeq) glutamate receptor 1-like
  KO
K05197  glutamate receptor 1
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106530599
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:alim04040]
    106530599
Ion channels [BR:alim04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   106530599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 106530599
NCBI-ProteinID: XP_013881704
UniProt: A0A2I4CP04
Position
Unknown
AA seq 263 aa AA seqDB search
MVSPIESAEDLAKQTEIAYGTLDGGSTKEFFKLSKIAVFEKMWSYMRSAEPSVFVKNTNE
GVMRVRKSKGKYAYLLESSMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSPLRIPVNL
AVLKLNEQAVLDKLKNKWWYDKGECGHKDSGRKDKTSALSLSNVAGVFYILIGGLGLAML
VALVEFCYKSRIESRRMKELIDAAMMSSSLGGMAGGVGGGGGAAAGLGGENGRVMAHNFP
KSGAQGLPCMGKAAGLGLSSTGM
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggtttctcccatagagagtgcagaagacctggccaagcagactgagatcgcctatggt
actctggatggtggctccaccaaagagttcttcaagctctcaaagatcgccgtgtttgag
aagatgtggtcgtacatgcgcagcgccgagccgtcggtgttcgtgaagaacaccaacgag
ggcgtgatgcgagtcaggaagtcgaaggggaagtacgcctacctgctggagtcctccatg
aacgagtacatcgagcagaggaaaccctgcgacaccatgaaggtgggaggaaacctggac
tctaaaggctacggagtggccacgcccaaaggctcccccctcagaatcccggtaaaccta
gcagtactgaagctcaatgaacaagccgtcttagacaagttgaaaaacaagtggtggtat
gacaagggggaatgtggacacaaggactccggcagaaaggacaaaacgagcgcgctcagc
ctgagcaacgtggccggggtcttctacattctgattggtgggytggggctggccatgctg
gtggctctggtcgagttctgctacaagtctcgcatcgagtccaggaggatgaaggaactc
atcgacgccgccatgatgagcagcagcctcggcgggatggccggcggggtcgggggcgga
ggaggagcggcggcggggctcggaggcgagaacgggcgagtgatggcgcacaacttcccc
aagtctggagctcagggtttgccctgcatgggcaaggcagcrggcctgggcctgtcctcc
acaggcatgtga

DBGET integrated database retrieval system