KEGG   Austrofundulus limnaeus (annual killifish): 106531303Help
Entry
106531303         CDS       T06063                                 

Definition
(RefSeq) erlin-2 isoform X1
  KO
K23341  erlin
Organism
alim  Austrofundulus limnaeus (annual killifish)
Brite
KEGG Orthology (KO) [BR:alim00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:alim04121]
    106531303
Ubiquitin system [BR:alim04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    106531303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Proteasome
Motif
Other DBs
NCBI-GeneID: 106531303
NCBI-ProteinID: XP_013882584
UniProt: A0A2I4CRI7
Position
Unknown
AA seq 348 aa AA seqDB search
MLYFVKIEGDVLKFCWMAQLGAVFSIIAALGGAALLASVHKIDEGHTGVYYRGGALLTTT
SGPGFHLMLPFITTFKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNYLIPSAVYDIV
RNFTADYDKALIFNKVHHELNQFCSVHSLQEVYIGLFDQIDENLKLTLQEDLTSMAPGLI
IQAVRVTKPNIPESIRRNYELMESEKTKLLISQQTQKVVEKEAETERIKAVIEAEKVAQV
AEIKFGQKVMEKETEKKISEIEDNAFLARQKAKADAEFYTALRAAEANKLKLTPEYLQLM
KYKAIAANSKIYFGNDIPQMFVDSGSVGSSVKASAALDIVGEQMLDLD
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgctgtattttgttaaaatagaaggagacgtgctaaagttttgttggatggcacagttg
ggggccgtcttctctataatcgctgctcttggaggagcagctctcttagcatctgttcac
aagattgatgaagggcacactggagtgtactacaggggaggggctctcctgactacaacc
agtgggccaggtttccacctcatgcttcctttcatcaccaccttcaagtctgttcagacg
acgttgcagacggatgaggtaaagaatgtaccctgtggtacaagtggaggagtgatgatt
tactttgaccgtatagaagtggtgaactacctcattccatcagcagtgtacgacatagtg
aggaacttcacagcagattatgacaaagctttgattttcaacaaagtgcaccatgaactc
aaccagttctgcagcgttcactcactgcaggaggtctacatcggtctgttcgaccaaata
gatgaaaacctaaagttgacactacaagaagatctgacatctatggcacctgggctcatc
atacaggctgttcgtgtcactaaacccaatatcccagagagcattcggaggaactatgag
ctcatggagagtgagaagacgaagctactgatttcccagcagacacagaaggttgtggag
aaggaggcggagaccgagaggattaaagctgtgatagaggcagaaaaagttgcacaagtt
gcagaaattaagtttgggcagaaagtcatggagaaggaaactgaaaagaagatttctgaa
atagaagataatgctttcctggcccggcagaaagccaaggcagatgcagagttctacaca
gcactgcgagccgccgaggctaataagctgaagttaactcctgagtacttacagctgatg
aagtacaaggccatcgcagccaacagtaaaatctactttggaaacgacatacctcagatg
tttgtggactctggctctgtgggcagctctgtcaaagcctctgcagccttggacattgtt
ggtgagcagatgctggacctggactaa

DBGET integrated database retrieval system