KEGG   Austrofundulus limnaeus (annual killifish): 106531498
Entry
106531498         CDS       T06063                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim00230  Purine metabolism
alim00240  Pyrimidine metabolism
alim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alim00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106531498 (dck)
   00240 Pyrimidine metabolism
    106531498 (dck)
Enzymes [BR:alim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     106531498 (dck)
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 Thymidylate_kin AAA_28 AAA_17
Other DBs
NCBI-GeneID: 106531498
NCBI-ProteinID: XP_013882830
UniProt: A0A2I4CS64
Position
Unknown
AA seq 275 aa
MPPVPKRPCSESTDDSMNDSLNCSMDESTERRIKRVSIEGNIAAGKSTFVRLLEQESPDW
EVVPEPIARWCNVQTTGSDFEELTTSQRSGGNVLQMMYEKPERWAYTFQSYACVSRIRAQ
TRAASRKLSVAQNPVQFFERSVYSDRYIFASNLYESECLNETEWSIYQDLHSWLHNQFVQ
HIQLDGIIYLRASPEKCLERLHLRGRQEEQEIPLEYLEKLHFKHESWLQHKKTAMEFEYL
RDVPVLTMDVNEDFNKNNIKSSDMIEKVKDFLSSL
NT seq 828 nt   +upstreamnt  +downstreamnt
atgcctcctgttccaaaaagaccctgttccgagtccacagacgactccatgaacgactcg
ttaaactgttcgatggacgagtccacggagaggagaataaaacgagtttcaatcgaaggg
aacattgcggcgggtaaatctacttttgtgcgccttttggagcaggagagcccggactgg
gaggtggtaccagaacccatcgccaggtggtgcaatgtccaaacaacaggaagcgatttt
gaggagctgaccacgtctcagaggagtggagggaacgtgctgcagatgatgtatgagaag
ccagagcggtgggcctacaccttccagagctacgcctgcgtcagccggatccgtgcccag
accagagccgccagcaggaagctcagcgtggcacagaaccccgtgcagttctttgagcga
tccgtttacagtgacaggtacatctttgcctccaacctttatgagagcgagtgcctgaat
gagactgaatggtccatctaccaggacctgcacagctggctccacaaccagttcgtccag
cacatccagctggatggtatcatttacctcagagcgtcaccagagaaatgtttggagagg
ttacacctgcgaggcagacaggaggagcaggaaatccctttggagtatctggagaagctg
cactttaagcacgagagctggctgcagcacaagaagacagccatggagtttgagtatctt
cgtgatgttcctgtgctgaccatggacgtgaacgaagactttaacaaaaataacatcaag
agttctgacatgattgagaaggtgaaggacttcttgagctcgctgtga

DBGET integrated database retrieval system