KEGG   Austrofundulus limnaeus (annual killifish): 106531685Help
Entry
106531685         CDS       T06063                                 

Gene name
thnsl2
Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Brite
KEGG Orthology (KO) [BR:alim00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106531685 (thnsl2)
Enzymes [BR:alim01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     106531685 (thnsl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 106531685
NCBI-ProteinID: XP_013883050
UniProt: A0A2I4CST5
Position
Unknown
AA seq 493 aa AA seqDB search
MRYCSTRGGVRGLDFKEVLFSGFAPDGGMFMPETVPVLSPDTLRSWRGLPYSRLVLEVCS
LFIPADLVPRDHLEGLVSEALSGFSVPEVVRIRGLRDGLWVLELFHGSTLAFKDLAMTCT
VQFTNYFLQQENRRAVVLVGTSGDTGGSAVHSSKGLPGLDVLVVFPRGRITAVQERHMST
CLEDNVHVFSAXGSSDDIDQSLRRLFADQDLVSSQNLMSLNSVNWSRVMVQVAHFLYAYL
ELSGLERTEAGPDLPELEVVVPTGGAGNITAAYILKLMGVPLKLVAMVNANDVVHRTVTS
GDFSMASAVTRTLAPAIDIQDPYNLERIFWLLLNKDGSSVRTIMEDFQGSHRHRLSEQHQ
KLLSGVLQTGTVSDQEILETMRRCWEENHYVLCPHSAVAVWHHYHHPPQTQVQRCYVATA
SPAKFQTAVEQAGLTFDPPEAVRALDHMPTRYQNLERSQNWCKDWEDRLRDWIQFVTSVR
KNQGACYQSPDQR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaggtactgcagtactcgtgggggggtccggggactggactttaaggaggtcctgttc
tcaggttttgctcctgatggggggatgtttatgccagagacggtcccggtcctcagtccg
gacaccctgaggagctggaggggtctgccgtactccagactggtcctggaggtctgctct
ctcttcatcccagcagacctggtccccagagaccacctggagggtctggtctcagaggct
ctgtcgggcttctccgtacctgaggtggtccggatacgtggactcagagacggtctgtgg
gtcctggagctgttccacgggtccacgttggccttcaaggacctggctatgacctgcacc
gtccagttcaccaactacttcctgcagcaggagaaccgcagagcygtggttctggttggg
acatctggagacacgggtggttctgctgtccacagttctaaaggtcttcctggtctggat
gtcctggtggtttttcctcggggccgcatcacggcggtgcaggagagacacatgtccacc
tgtttggaggacaacgtccacgtsttctcagctgamggcagctcagacgacatcgaccag
tctctccgtcgtctcttcgctgatcaggacctggtctcgtctcagaacctgatgagcctc
aactctgtcaactggtccagggtcatggtccaggtggcccacttcctgtacgcctacctg
gagctcagcgggctggagaggaccgaggcggggccggacctgccggagctggaggtggtg
gttccaactgggggggcggggaacatcacagctgcctacatcttgaagctgatgggtgta
cctctgaaactggttgccatggtgaacgctaacgacgtcgttcaccggaccgtgaccagt
ggagacttctccatggcctcagccgtcacacggactctggctccggctatagatattcag
gacccgtacaacctggagcggatcttctggctgctgctgaacaaagacgggtcttcagtc
agaaccatcatggaggactttcaggggtctcatcggcaccgcctgtctgagcagcaccaa
aaactgctgtcgggggtcctgcagaccggcacggtgagcgatcaggagatcctggagacc
atgaggaggtgctgggaggagaaccactacgttctgtgtcctcacagcgccgtggccgtg
tggcaccactaccatcatcctccccagacccaggtccaaaggtgttacgttgccacggcg
tctccagcaaagttccagacagcagtggagcaggcaggtctgacctttgaccccccagag
gcggtgcgggccctggaccacatgcccacccggtaccagaacctggagaggagccagaac
tggtgcaaagactgggaggaccgactgagggactggatccagtttgtgacctcggtcagg
aagaaccaaggagcctgttatcaatcacctgatcagagatga

DBGET integrated database retrieval system