KEGG   Austrofundulus limnaeus (annual killifish): 106532693Help
Entry
106532693         CDS       T06063                                 

Gene name
nsun2
Definition
(RefSeq) tRNA (cytosine(34)-C(5))-methyltransferase
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Brite
KEGG Orthology (KO) [BR:alim00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:alim03016]
    106532693 (nsun2)
Enzymes [BR:alim01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     106532693 (nsun2)
Transfer RNA biogenesis [BR:alim03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    106532693 (nsun2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 106532693
NCBI-ProteinID: XP_013884275
UniProt: A0A2I4CWC2
Position
Unknown
AA seq 763 aa AA seqDB search
MGKRSRQRQKNQNAGSRDDRDSAGWGAGYADIVKENKLFEHYYKEQGLIPEGEFEQFMEA
MREPLPATIRITGYKSHAKEILHCLKGKYFKDIQDLEIDGQKIEAPQPLSWYPDEQAWHT
NMSRKLIRKSPLLEKFHQFLISETESGNISRQEAVSMIPPLLLKIESHHKILDLCAAPGS
KTAQLIEMLHSDMDVPFPEGFVIANDVDNKRCYLLVHQAKRLNSPCIMVVNHDASCIPTL
QVQSDGKKDILFYDRVLCDVPCSGDGTMRKNIDVWKKWTTSNSLHLHGLQLRIAVRGVEQ
LAVGGRMVYSTCSLNPIEDEAVIAALLEKSEGALELADASGDLPGLKWMPGVTSWKLMTK
EGQWFSDWSEVPTSRHTQIRPTMFPPKDVEKLADMHLERCMRILPHHQNTGGFFVAVLVK
KAPMPWNKRYPKLRTNPSSSSSAQTAGSSAASSPADNPHLPTDGSPEEVEEDGSGGKGDE
EAEHEAPSGAALAQEAGGKQDARCGPPPSKKLRLFGYKEDPFVFLTEDDPVFNTIQSFYD
MSPDFPKLNVLTRTHEGKKRHLYMVSKELRNVLLNNSERMKVINTGVKVWSRNSDGEEFG
CAFRLAQEGIYTLQPYIRSRIIRVSVEDIKVLLTQENPFLSKLEDAAHAQAKQMGMGSIV
LKYIPNPNNPTEPQCSIQLCGWRGKTSIRAFVPRNERFHYLRMLGVEVFRDKQGQTLKSR
DGKKEEEEVEGEETAAVENEAELENGGEDQAAEPKTDSSNKES
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacgaagcaggcagaggcagaaaaaccagaatgctggcagcagagacgacaga
gacagcgctggctggggagcaggctacgcagacatcgtcaaagagaacaagctgtttgag
cattactacaaggaacaaggcctgatccctgagggagagtttgagcagttcatggaggcg
atgagggaacctctgccagcaaccatccgcatcactggatataaaagccacgccaaggag
atcctccactgtttgaagggaaaatatttcaaggatattcaagatttggaaatcgatggc
cagaagattgaagccccacagcctctcagctggtatcctgatgagcaggcctggcacacc
aacatgagcaggaagctcattaggaagtctcccctgctggagaagtttcatcagttcctc
atcagcgagacggagtctggtaacatcagccgacaggaagctgtcagcatgatccctcct
ctgctcctgaagattgagtcccatcacaagatcctggacttgtgtgcagctccggggtca
aagacggctcagctgattgagatgcttcactctgacatggacgtgccgtttccagagggt
tttgtgatcgccaacgacgtggacaacaagcgctgctacctgctggttcatcaggccaag
cggctcaacagcccctgcatcatggtggtcaaccacgacgcctcctgcatccccacactc
caggtccaatcagacggcaagaaggacatcctcttctatgaccgtgtcctgtgtgacgtg
ccctgcagtggggacgggaccatgaggaagaacatcgacgtgtggaagaaatggacgacc
agtaacagcctccacctccacgggctccagctgcgtattgcagtgcgcggggttgagcag
ctggctgtgggaggcaggatggtttattccacctgttcactcaaccctatagaggacgaa
gctgttatcgcagcactgctggagaagagtgaaggagcgttggagctggctgatgcgtcc
ggtgacctccctggactgaagtggatgcctggggtcacttcctggaagttaatgaccaaa
gagggccaatggttctcggactggtccgaggttcccaccagtcgtcacactcagatccgt
ccgacgatgttcccccccaaagatgtggagaaattggccgacatgcacctggagagatgt
atgaggattctgccacatcatcagaacacaggagggttctttgtggctgtgctggtgaaa
aaagccccgatgccctggaacaaaagatatcctaagttgaggacgaacccctcgtcgagc
tcatcagcccaaactgccggctcctctgcagcctcgtccccagctgacaacccccacctc
cccactgatggctccccagaggaggtggaggaagatggctcaggagggaaaggagacgaa
gaggcagagcatgaggcgccttcaggagctgctttggctcaggaggctggtggtaaacaa
gatgcacggtgtggacctccaccctctaaaaagctgaggttgtttgggtataaagaagac
ccctttgtgttcctgactgaagacgatcccgtcttcaacaccatccaatcgttctacgat
atgtctcctgacttccccaaactcaacgttctgaccagaacccacgaaggcaagaagaga
cacttgtacatggtgtccaaagagctgcgcaacgtgctgctaaacaacagcgagcgcatg
aaggtcattaacaccggggtgaaggtgtggtctcgtaacagtgatggagaagagtttggt
tgtgccttcagactggctcaggagggaatctacacccttcagccgtatattcgctccagg
atcatcagagtgagtgtggaggacatcaaagtgctgctgactcaggagaaccctttcctc
agcaaactggaggacgccgctcacgctcaggccaaacaaatgggaatgggcagcattgtg
ttgaagtacatcccaaacccaaataaccccactgagcctcagtgttccatccagctgtgc
ggctggaggggaaagacctccatccgagccttcgtcccccgaaacgagcgctttcattat
ctccgtatgttgggcgtggaggtgttcagagacaaacagggccagacgctgaaaagtagg
gatggaaagaaggaggaggaggaggttgagggggaggaaacggcagccgtggaaaacgag
gcggagcttgagaacggcggtgaagaccaagcagcggaaccaaagactgacagcagcaac
aaggagagctag

DBGET integrated database retrieval system