KEGG   Austrofundulus limnaeus (annual killifish): 106533266Help
Entry
106533266         CDS       T06063                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase-like
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim00120  Primary bile acid biosynthesis
alim01100  Metabolic pathways
alim03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:alim00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    106533266
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    106533266
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:alim00199]
    106533266
Enzymes [BR:alim01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     106533266
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     106533266
Cytochrome P450 [BR:alim00199]
 Cytochrome P450, animal type
  CYP8 family
   106533266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 106533266
NCBI-ProteinID: XP_013884961
UniProt: A0A2I4CY84
Position
Unknown
AA seq 509 aa AA seqDB search
MELLLTILLSIFVALVGGLYLLGVFRKQRPGEPPLDKGLIPWLGHVLEFRRDTFKFLDRM
KKKHGDVFTVQLAGYYFTFLQDPLSFGAFVKESREKLDFNRFAEQLVKKVFGYVSIEEDH
HILQNTSNKHLKGEGLGVMTQAMMSNLQNLMLHSIGSEQKTWKEDGLFMLSYNIVFRAGY
LALFGNVPHKSKGGEVKAKEEDRTQSETLFYEFRKYDQLFPNLAYGVLPPKDKWEADRLQ
SFFWDAVSVEKMKNKDNISRWVWDMQLAKEEMGMEESMINKYMFLLLWASQGNTGPSSFW
LLLFLLKHPEAMEAVRKEVDKVLKETGQEVKPGGPLVDLTREMLTKTPILDSXVEETLRL
TAAPLLTRAVLQDMTLKMADGREYFIRKGDRMAIFPYSAVLLDPEIHPDPLSFKYDRFLN
PDGSKKTEFYKAGKRVKYYNMPWGAGVSMCPGRXFATNELKQFVFLMLVYFEFELKNPDE
KIPEIDFRRWGFGSMQPDRDVQFRYRLRY
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgttgacgattcttttgagcatttttgtagcactggtcggtggactgtac
cttcttggggttttccgaaagcagagaccaggagaaccccctctcgacaagggtctcatt
ccatggctgggccatgtgctagaatttcgcagagacactttcaagttcctagacaggatg
aagaagaaacatggtgatgtcttcacagtacagctggctggatattacttcactttcctc
caggatcctctatcgtttggggcttttgttaaggagagtcgagaaaagctggacttcaac
agattcgcagaacagctggtcaagaaagtgtttgggtatgtaagcattgaggaagatcac
cacatccttcagaataccagcaataagcatctgaagggagaaggcctgggtgtaatgaca
caagccatgatgagcaatttgcagaacctgatgttgcacagcatcggctcagaacagaag
acctggaaggaagatggcctgttcatgctcagctacaacattgtgttcagagcaggctat
ttagctttgtttggaaatgtgccacacaagtcaaagggtggtgaggtgaaagccaaagag
gaagacagaactcagtctgaaactttgttttatgagtttcgtaaatatgaccaacttttc
cccaacctggcctacggggtccttcccccaaaggacaagtgggaagctgacaggttacag
tccttcttctgggacgctgtgtcagtggagaagatgaaaaacaaggacaacatcagtcgc
tgggtgtgggacatgcagcttgccaaagaggagatgggcatggaggagtcaatgatcaac
aagtacatgtttctgcttctttgggcttctcagggtaacacgggaccttcttccttctgg
cttctgctcttcctcttgaaacacccagaggccatggaagcagtcagaaaagaggttgat
aaagtcttaaaggagactggacaggaagtcaaacctggtggccccctggttgacctgacc
cgtgaaatgctcacaaaaacaccgatcctggacagckcwgtggaggagaccctccggctc
acagctgcacccctcctcaccagggcagtgctccaggacatgaccctcaagatggctgac
gggcgtgaatacttcattcgtaaaggagaccgcatggcaatctttccttacagcgccgtt
cttcttgacccagaaatccaccctgatcctctgtccttcaagtatgaccgctttttgaat
ccagacggcagcaagaaaactgagttttacaaagcagggaagagagtgaagtattacaac
atgccctggggtgcaggggtctctatgtgtccggggcgatwttttgccaccaatgagctg
aaacagtttgttttcctcatgttggtgtattttgagtttgagctgaagaatcctgatgag
aagattcctgaaatcgacttcaggcgatggggcttcggctcgatgcagcctgacagagat
gttcagtttcgatacagactgagatattaa

DBGET integrated database retrieval system