KEGG   Austrofundulus limnaeus (annual killifish): 106533675
Entry
106533675         CDS       T06063                                 

Definition
(RefSeq) uncharacterized protein LOC106533675
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
alim  Austrofundulus limnaeus (annual killifish)
Brite
KEGG Orthology (KO) [BR:alim00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:alim03000]
    106533675
Transcription factors [BR:alim03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    106533675
SSDB
Motif
Pfam: PAS HLH PAS_3
Other DBs
NCBI-GeneID: 106533675
NCBI-ProteinID: XP_013885549
UniProt: A0A2I4CZY9
Position
Unknown
AA seq 664 aa
MIPPGDCMYAGRKRRKPIQKQKPSSANEKSNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQASQDKTSRKPITSPASSNPEPRXESLPLGTAINESSLLL
ESLTGFALVVSCDGMVFYASSTIVDYLGFHQTDVMHQNIFDYIHIDDRQEFRHQLHWAMC
PPQHQGGSGPPESQLAAGTGDDFVLSSMFNSPEAGEVSPELSCFLNRCFITRVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSALGAQVPSQLALFCVAVPLLLPSVTEMKVKNILMRGKN
KGGGIMDCGERGEHLRRHSINGGMSDITDPPFSNAQRGHHTPWTSLCKDNLKYRPDGYYN
QEEPLNYCKSSMAVHKGVGSGMAGGWPPRQNLGLVRAAQEVGYNPSTRLNRTGQYGKPYR
RRDEVFVSKLYGNVQIPTDPDFFCVDLVKCENDYGECYDGHLMPDMQPIKVEHDSDSENG
CDTYGQNWAVDRRYSNGMYDPSSGLQLKSEAEYYDPQYSPCQRGKAGISPPYNGSYPNYA
VNNSGVNATRLPKCGKDLGGNGDSSQFSSQKLSHSDSLCNNQSVNLMDSNVYSHKAYMQP
DYNKHYEFKGHGLVHSIKREPMDSPPWSENGHDINQSMMTGPRNVMPCGMSTGHHKSSPY
SYMQ
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgatccctccaggagactgcatgtatgctggcaggaagaggaggaaacccatccagaaa
cagaagccgtcttcggctaacgagaaaagcaacccgtccaaacggcaccgggaycggctg
aacgcggagctggaccggctggccagcctgctgccgttccccccggacgtcatctccaaa
ctggacaagctgtcggtgctgcgcctcgccgtctcctacctccgcgtcaagagcttcttc
caagcgagtcaagacaagacgtccaggaagcccatcaccagcccagcatcctctaaccct
gaacccaggaragagagccttccactgggcacggccatcaacgaaagcagcctcctcttg
gaatctctgacaggctttgccctggtggtgagctgtgacgggatggttttctacgcttcc
tccaccatcgtggattatctgggatttcaccagactgatgtgatgcaccagaacatcttc
gactacatccacatagatgaccggcaggagttcagacaccagctgcactgggccatgtgt
cctccacaacaccaggggggttctggaccaccggagagccaactagctgcaggaacgggt
gatgactttgtgctgagcagcatgtttaactctccagaagcaggagaggtttctcctgag
ctctcctgcttcctcaacagatgttttatcaccagagtccgatgtctcctggacagcacc
tctggattcttgaccatgcagtttcaaggtcggttgaagttcctccacgggcagaagaag
aagtctgccttgggggcacaagttccctctcagctcgcccttttctgcgtcgctgtacct
ctcttactgccctcagtcactgagatgaaagtgaaaaatatcttaatgcggggcaaaaac
aaaggaggagggattatggattgtggtgagcgtggagaacacctgaggagacactccatc
aatggaggaatgagtgacatcacagatccacctttttccaatgcccagcgaggccaccac
accccctggacttctctctgcaaagacaacctcaagtaccgtcctgacggctactacaac
caggaagagcccctcaactactgcaagtcctccatggccgtccataaaggtgtcgggtct
ggcatggcaggtgggtggcccccaagacagaacttgggtctcgtcagagcggctcaggag
gtcggctacaacccctccacccgyttgaacaggactggccagtacgggaagccttaccgc
agaagggacgaggtgttcgtctccaagctctacgggaacgtccagatcccgacagaccca
gatttcttctgcgtggacctggtgaagtgcgagaacgactacggagaatgctacgacggc
cacctaatgcccgacatgcaacctatcaaggtggagcacgactccgactcggagaacggg
tgcgacacgtacggacaaaactgggcagtcgaccgtcgttacagtaacgggatgtacgac
ccgagctctggcttgcagctcaaatcagaggcagaatattacgacccacagtactcaccc
tgtcagcgaggaaaagcaggaattagcccgccgtacaacggcagctacccaaactatgca
gtcaacaacagcggggtcaacgccacgcgcctgccaaagtgtggcaaagacttggggggc
aacggcgactccagccagttcagctcccagaaactctctcactcagactccctatgcaac
aaccaatcggtcaacctcatggactctaatgtctactcgcacaaggcctatatgcaaccg
gactataataagcattacgaattcaaaggtcacggcctggtccattcaattaaacgggag
cccatggactccccgccttggtctgagaatggtcacgacatcaaccagtccatgatgacc
ggtccaaggaacgttatgccttgtgggatgagcacaggccaccacaagtcaagcccctac
tcctatatgcagtga

DBGET integrated database retrieval system