KEGG   Austrofundulus limnaeus (annual killifish): 106535238Help
Entry
106535238         CDS       T06063                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 15-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04060  Cytokine-cytokine receptor interaction
alim04068  FoxO signaling pathway
alim04210  Apoptosis
alim04217  Necroptosis
alim05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106535238
   04068 FoxO signaling pathway
    106535238
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106535238
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106535238
   04217 Necroptosis
    106535238
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106535238
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:alim04147]
    106535238
   04052 Cytokines and growth factors [BR:alim04052]
    106535238
   04090 CD molecules [BR:alim04090]
    106535238
Exosome [BR:alim04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106535238
Cytokines and growth factors [BR:alim04052]
 Cytokines
  Tumor necrosis fators
   106535238
CD molecules [BR:alim04090]
 Proteins
  106535238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 106535238
NCBI-ProteinID: XP_013887649
UniProt: A0A2I4D601
Position
Unknown
AA seq 137 aa AA seqDB search
MVVAPLSSSQSTSTGGYLQWDITHSARKQVSHSHSTWLTILEPGDYFVYTRVTFSKDHPK
LALASRVKMRKGETAEDKDVMKAYCSLSGDTSSPQMCTATQQDVITLEKGNQLSVWVQDL
SLVDYEEGATTFGIYKL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcgcgcccctttcaagttcacaatcaacctctacaggtggttatctccagtgg
gacataacccactcwgctcgaaagcaagtcagccactctcacagcacctggctgaccatc
ctggagcccggcgattacttcgtctacaccagggtaaccttctccaaagaccacccaaag
ctcgcactggccagcagggtcaagatgaggaagggggaaaccgcagaggacaaggatgtg
atgaaggcctactgcagcctgagcggggacacgtcaagccctcagatgtgcacggccacg
caacaggatgtgatcacgctggagaagggaaaccagctcagcgtctgggtgcaggacctc
tcacttgtggactacgaagaaggcgcaacgacctttgggatttacaaactatag

DBGET integrated database retrieval system