KEGG   Austrofundulus limnaeus (annual killifish): 106535442Help
Entry
106535442         CDS       T06063                                 

Gene name
wnk4
Definition
(RefSeq) serine/threonine-protein kinase WNK4 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Brite
KEGG Orthology (KO) [BR:alim00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:alim01001]
    106535442 (wnk4)
   01009 Protein phosphatases and associated proteins [BR:alim01009]
    106535442 (wnk4)
Enzymes [BR:alim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106535442 (wnk4)
Protein kinases [BR:alim01001]
 Serine/threonine kinases: Other
  Wnk family
   106535442 (wnk4)
Protein phosphatases and associated proteins [BR:alim01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106535442 (wnk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal DUF2956
Motif
Other DBs
NCBI-GeneID: 106535442
NCBI-ProteinID: XP_013887899
UniProt: A0A2I4D6P3
Position
Unknown
AA seq 1503 aa AA seqDB search
MSKITSGSEPATIMSHAQVERPGLAFPGLSVDMTDDCLSRVPTVLRTHGLGARRNSYGLQ
KITMDIDSPLYSSALSKALSWSAENILTLAESRAEEEEEKTDETPPPSSPPAASSSGGGG
GGSAPXGSREPAPGGSRSSAHDASSDSDNDLHLKQTKILSRITFDTQWEQEEKEDVETKA
VATSPDGRYLKFNIEIGRGSFKTVYKGLDTETTVDVAWCELQTRKLTKAERQRFSEEVEM
LKGLQHPNIVRFHDSWKSTMKGHKCIILITELMTSGTLKTYLKRFKEMKLKLLQRWSRQI
LKGLHFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKSASFAKSVIGTPEFMA
PEMYEEKYDEAVDVYALGMCILEMATSEYPYYECQNAAQIYRKVTSGIKPDSFYKVKVPE
LKEIIEGCIRMNKDERYTIQDLLDHPFFQENNGVHVELAEEDDMVKPDLKLWLRMDDTKK
LHGKYKDNNAIEFLFELYKDVPEEVAQEMVVLGFVCEADFKIVAKAIRDRVTTIKRQREK
LQRQAERKRKQAREAIEEEPEPQSPSPKVSDVITARSPTPALTPLASMTSPITSSADSGV
SSSYPAEPEEPEVDQHFHVRYNSLSSANSDCETDGDQSSSGLQDPLEANSFNSPASPSNT
QTSSPVVNGLPFPAVRFPSSIAVLSNTERGHSGPASDFSSPVDSYASDVTSGLSDGYEGL
SEKSEKSAAKRNAAKLFRRRARSRLRITGLSDKADRVVECQLQTHNDKMVTFKFDLDGDN
PEDIAAVMVHKEFILPSEKEGFIHRMGDIIKRAEALMAKEPPVHPSTLRLAQLASHGGVN
SLSTSQPNLHSHTIPRTHSSSSLPDDSVANPTVGLRGAALRPNGEVFGPDIASPGRPLLR
SQSFHYAPGSPLAYQHHSRTSSLLSHQQHYHVPYLGQTHFPFPYPGSPGSPKPAGVHPPL
TRVASNPTFPSVPSPTPSSPSPINETFSPTNESATMSPPTPQQQHPNMWPAHTQPLFSLA
NVISMAMSMAQSFIPPGNLPTQGMPPYPGFHPQLPSPLASQPGYPALYPNHYQAPAQPVE
LPYLPVGIYPSPEAAPHMEAAAFYHNLHPQWQHPVSPPSVPSTPSTPPQAARPSGSPSPT
KEDGSTAPHSAQLQPKTSSDGSKSSDLSPPPPVSPKNKVSSVSSHFHPAGPETNTSPTKL
KTSPDXSVTVGRFQVTPSIDIPDPVAPAAPQTTGSPQSESSTEEQVESETSMGTSLTMSP
PHPDRGTSTGVQQEAGNPPGWAVSQEQQQQQHRRHDRGGEGEEGEDEEEEEVLEERSRAR
KRGRRRTCSLSLMGTSADSGLSVTAADPEGRLWDGAAGSPQYGNALHHLWMTTYNRNTPY
LSSDDSDSDGEEMLVELQELREKHLSEVQTLQAAQKREIEELYERMGKVPPPGIVSPAAM
LSSRQRRLSKGSGFSSSRRNSLQRVDMVPLQGIIRRNSLGSSSSGSQDKHSKGVTFAKDI
SRM
NT seq 4512 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcacatcaggatctgaacctgccacaataatgtctcacgcacaggttgag
agaccaggactggctttcccgggcctctccgtggacatgacggacgactgcctgtcccgg
gtccccaccgtgctcaggacgcacggcttgggcgcgcggaggaactcgtacgggctgcag
aagatcaccatggacatcgactctcctctgtacagcagcgccctgtccaaagccctgtcc
tggtccgccgagaacatcctgacgctggccgagtccagagcggaggaggaggaggagaaa
accgacgagactccgccgccctcctccccgccggcggcttccagctccggcggcggcggc
ggaggaagcgcgcccmcgggcagccgtgagcccgccccgggggggtccaggtccagcgct
cacgacgccagctcggactccgacaacgaccttcacctcaaacagaccaagatcttgtcc
cgcatcacctttgacactcagtgggagcaggaggagaaggaggacgtggagaccaaagct
gtggcgacctctccggatggaaggtacctcaagttcaacatagagatcggcagggggtcc
ttcaagacggtctacaaaggtctggacacagagactaccgtggaygtggcatggtgtgaa
ctccagacacgtaagctaaccaaagcagagcggcagcgtttcagcgaggaagtggagatg
ctaaagggcctccagcacccaaacatcgttcgcttccacgattcctggaagtcgacgatg
aagggccacaagtgcatcatcctcatcactgaactcatgacctccggcactttaaagacg
tacttgaagaggttcaaagagatgaagctgaaactgctgcagcgctggagtcgtcagatc
cttaaagggcttcacttcctgcacacgcgcactcctcccatcatccaccgggacctcaag
tgtgacaacatcttcatcaccggccccaccggctccgtcaagatcggtgacctggggctg
gccacgcttaaaagtgcctcttttgctaaaagtgtcattggaacaccagagttcatggcg
ccggagatgtacgaggagaagtacgacgaagccgtggacgtctacgccttggggatgtgc
atcctggagatggccacctcrgagtacccgtactacgagtgccaaaacgccgcccagatc
taccgcaaagtcaccagcggcattaaacccgacagtttctacaaagtaaaagtcccagaa
ctcaaagagatcatcgagggctgcattcgtatgaacaaagatgaaaggtataccattcag
gacctcctggatcacccgttcttccaggagaacaacggcgtgcacgtggagctggcggag
gaggacgacatggtgaagccggacctgaagctgtggctgcgcatggacgacaccaagaag
ctccacgggaagtacaaggacaacaatgccatagagttcctcttcgagctctacaaagac
gtgcccgaggaggtggctcaggagatggtcgtgcttggcttcgtgtgcgaggcggacttt
aagatcgtggccaaggccatacgagacagggtgacgaccatcaagaggcagagggagaag
ctgcagcggcaggcggagcggaagaggaagcaggcacgagaggcgatcgaggaagagccg
gagcctcagtcgccttcgcccaaagtcagcgatgtcatcacagccaggtcccccaccccg
gccctgacgcccttggcctccatgacgtcccccatcaccagctctgcagactccggcgtc
agctccagctaccccgcagagccggaggagcccgaggtggatcagcacttccacgtccgc
tacaacagcctgtcttcagctaactctgactgtgagacggacggcgaccagagttcctcc
ggacttcaggatccactggaggccaacagctttaactcccccgcatccccttcaaacacg
caaaccagctcccccgtagtaaatggcctcccctttccagccgtgcgcttcccttcgagc
atcgcagttctcagtaacacagaacgcggacattcaggacctgcaagcgacttcagctca
cctgtagacagctacgcctccgatgtgacctcaggtctgagcgacggttacgagggcctg
tcggagaagagcgagaaatccgccgcgaagcgaaacgccgccaagctgttcaggaggagg
gcgcgctccaggcttcgcatcacagggctctctgacaaagcygaccgagtggtcgagtgt
cagctgcagacgcacaacgacaagatggtgaccttcaagttcgatctggacggagacaac
ccagaagacattgctgctgtcatggtgcacaaagagttcatcctcccctcagagaaggaa
ggattcatccatcgaatgggtgacatcatcaaacgtgccgaggctctgatggccaaagag
ccgccggttcaccccagcacgctgcggctcgcacagctggcatcccacggcggcgtgaac
tccctgtccacgtcacagcctaatctgcacagccacaccattcctcgaacacactcctcc
tcctctctgcctgacgacagtgtggctaacccgactgtaggyctgcgtggcgctgccctg
cgtcctaacggcgaggtcttcggtccagacattgcttcacctgggcgacctcttttacgc
tcgcagtctttccactacgccccaggttctccgctcgcctaccagcatcacagccgcacc
tcttctctgctctcccaccagcagcactaccatgtgccctacctgggccagacgcacttc
cccttcccttacccgggttctccgggttctccgaagccagcgggggtccacccgccgcta
actcgggtagccagcaaccccaccttcccgtccgtgccctccccyacccccagctccccc
agtcccataaatgagaccttcagccctacaaacgagagcgccaccatgtccccgccgacg
ccgcagcagcagcaccccaacatgtggcccgcccacacgcagccgttgttctccctggcg
aatgtcatctccatggccatgagcatggcccagtccttcatcccccccggtaacctcccc
acccagggcatgcccccctatccgggcttccacccgcagctacccagcccmttagcctct
cagccgggttaccccgccctctacccgaaccattaccaggccccagcgcagcctgtggag
ctcccctacctgccggtgggcatctacccaagccccgaggctgcgcctcacatggaagca
gcggcgttttaccacaaccttcatccacagtggcaacatcccgtgtcgccaccttccgtg
ccttccaccccgtccactcctccacaggcagccagacccagcggctcccccagtcccact
aaagaggacggctccactgcaccacactcagcccagctgcagccaaaaaccagttcagac
gggtccaagtcgtcagatctttccccgccacctcctgtgagccckaaaaacaaagtgtcc
tcagtcagtagtcacttccatccagcaggacctgagacaaacaccagtcctacaaaactg
aaaacttctcctgatgratctgttaccgtcgggaggttccaggtgacccccagcatcgac
atccccgaccccgtcgcacccgctgcaccgcagacgaccgggagcccccagtctgagagc
agcacggaggagcaggtggagtctgaaaccagcatgggcacctccctcaccatgtcccct
cctcaccccgacagaggcacttccacaggggtccagcaggaggctggcaacccaccyggg
tgggctgtgagccaggagcagcaacagcagcagcatcgtcgacacgacagaggaggtgaa
ggagaagaaggtgaagacgaggaggaggaggaggtgctggaggagcggtcgagggcgagg
aagagagggcgcaggaggacgtgcagcctcagcctgatggggacatcggccgacagcggc
ctctcggtgaccgccgccgaccccgaggggaggctgtgggacggcgcggcggggagccct
cagtacggcaacgctcttcatcacctgtggatgacgacgtacaaccgaaacaccccgtac
ctgagcagcgacgactcggacagcgacggcgaggagatgctggtggagcttcaggagctc
agagagaaacatctgtcagaggtccagactctgcaggcggcccagaagagagagatcgag
gagctgtatgagaggatggggaaggttcccccgccgggcatcgtctctcctgctgccatg
ctgtccagtcggcagcgccgcctgtccaaagggagcggcttctcctcgtctcgcaggaac
agtctgcagcgcgtggacatggtgcccctccaaggcatcattaggagaaactctctcggc
agcagcagcagcggctcgcaggataaacacagtaaaggcgtcacctttgccaaagacata
agtagaatgtaa

DBGET integrated database retrieval system