KEGG   Algoriphagus sp. M8-2: AO498_11365Help
Entry
AO498_11365       CDS       T04334                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
alm  Algoriphagus sp. M8-2
Pathway
alm00072  Synthesis and degradation of ketone bodies
alm00280  Valine, leucine and isoleucine degradation
alm00650  Butanoate metabolism
alm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AO498_11365
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AO498_11365
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AO498_11365
Enzymes [BR:alm01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     AO498_11365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AMQ57035
UniProt: A0A142EPI0
Position
complement(2591688..2592383)
Genome map
AA seq 231 aa AA seqDB search
MINKTVKNAQEAVADIPNGAFLMMGGFGLSGIPENCISALLDREIKGLTIVSNNAGVDDF
GIGLLLKKKMVKKMISSYVGENAEFERQLLSGELEVELIPQGTLAERVRAGGAGIPAFFT
PAGVGTEVAIGKETREFDGKLYLMERALIADFSLIKAWKGDTAGNLIFKGTSRNFNPMMA
AAGKITIAEVEELVPVGELDPNQIHTPGIYVQRIFQGEDYEKRIEQRTISR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgatcaataaaaccgtaaaaaatgcacaagaggcagtcgccgatattcctaatggtgct
ttcttgatgatgggaggttttggccttagtggaattccagaaaactgcatttcagcgctt
ctcgatcgagaaattaaaggcctcaccattgtttctaacaatgctggtgtggatgatttt
ggaattggccttcttttgaagaaaaagatggtcaaaaaaatgatttcgagctacgtaggt
gaaaatgcagaatttgaacgtcagttgttgagtggagaattggaagttgaattgattcct
cagggaactttagctgagcgagtaagggctggaggagcaggaatccctgctttttttaca
ccagctggggtgggtacagaagtagcaattggaaaggaaacacgtgagtttgatggtaag
ctttatttgatggaaagagcgttgatcgctgatttttctctgattaaggcctggaaaggt
gatacagccggcaacttaatctttaaaggtacctctagaaatttcaatcctatgatggcg
gctgctggtaaaattaccatagcagaagtggaagaattagttccagttggggaattagat
cctaatcaaattcacacgcctggaatttatgtacagcggatttttcaaggagaagactat
gagaaacgaatagagcagcgtacaatttcccgctga

DBGET integrated database retrieval system