KEGG   Alcanivorax sp. NBRC 101098: AS19_00820Help
Entry
AS19_00820        CDS       T03879                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
aln  Alcanivorax sp. NBRC 101098
Pathway
aln00430  Taurine and hypotaurine metabolism
aln00460  Cyanoamino acid metabolism
aln00480  Glutathione metabolism
aln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aln00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AS19_00820
   00460 Cyanoamino acid metabolism
    AS19_00820
   00480 Glutathione metabolism
    AS19_00820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aln01002]
    AS19_00820
Enzymes [BR:aln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     AS19_00820
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     AS19_00820
Peptidases and inhibitors [BR:aln01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   AS19_00820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: BAP12933
Position
complement(84888..86573)
Genome map
AA seq 561 aa AA seqDB search
MRHLLSLLLLITITAQAAGPGKSAVASAHPLATQAGLNILEQGGNAFDAAVAVAATLAVV
EPYSAGMGGGGFWLLHREQDGLQTFVDARETAPDAATAAMYQNKEGKVMRDWAVNGPSAA
GIPGQAAAFVHLADNYGKLPLTSTLAPAIALAEHGFHVEEHYRKLAGYRKDVLNRFPEAA
AIFLHNGKVPPNNHLIKQADLARVLRALAEKGNAGFYQGEVAKQLVDGVQQAGGIWTLDD
LANYKVVERTPTVSQFRGGRVISAPPPSSGGIVMGEALNILSQLNDGNTAEITPHLAIEA
MRRAYQDRARYLGDPDFVDIPVDKLLSIGYAKQRASSITLDKATASSSLGEPVGVEEGFH
TTHFSVLDKDGNRVAATLSINLPFGSGFVAPGTGVLLNNEMDDFSAKPGSPNAYGLVGSQ
ANAIAPGKRPLSSMTPTFVEFDDRIAILGTPGGSRIISMVMLAVLEASNNKPVEDWVNAV
RYHHQYLPDEVQAEPAFIDSQAAKDLVRRGHKVVSTGRNYGNMQAILWRQDSGEVTAASD
PRGIGSAEIRAPHSSKEQSTE
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatctgctttcgctcctgctgctaattactattaccgcccaggccgccgggcca
ggcaagagtgcggttgccagtgcccatccactggcaactcaggctgggctgaatattctg
gagcagggcggcaatgcctttgatgcggcagtcgcggtggccgccactttggccgtggtc
gaaccctattctgccggcatgggcggcggtggcttctggctgctacaccgggaacaggat
ggcttgcaaacctttgtagatgcccgcgaaacggctcccgacgcggccaccgctgccatg
taccaaaacaaagagggtaaggtgatgcgcgactgggcagtaaacggccccagcgctgcc
ggcattcccggccaagccgccgctttcgtccatctcgcggacaattacggtaagttgccg
ctcacttccactctagcccccgctattgctttggccgaacacggcttccatgtagaggag
cattaccgcaaattagcaggttaccggaaagacgtgcttaaccgctttccggaagccgcc
gctatcttcctgcacaacggcaaggtgccgcccaacaaccacctgatcaaacaagcagat
cttgcccgggtactcagagccctcgctgaaaagggaaacgcgggcttttatcagggcgaa
gtggccaaacagctggtagacggagtgcaacaagctggcggtatctggacactggacgat
cttgctaactataaggttgtagagcgcacccccaccgtcagccagttccgcgggggccgg
gtaatctcagccccaccaccgtcgtctggcggcatcgttatgggcgaagcgctcaatatt
ctcagccaactcaacgacggcaacaccgcagaaataaccccgcacctggccatcgaggcc
atgcgccgcgcctatcaggacagggcacggtatcttggcgacccggactttgtggatata
cctgtggataagctgttgagcataggctacgccaagcaacgcgccagcagtattactctc
gacaaggccactgccagcagcagcctgggcgagcccgtcggcgtagaagaaggctttcat
accacccatttttcggtactggataaagacggcaatcgagtggccgctacgctaagcatt
aacctgccattcggtagcggctttgtggcccccggcaccggcgttcttctcaataacgaa
atggacgacttctccgccaaacccggcagccccaatgcctatggcctggtcggcagccag
gccaacgccattgcccccggcaagcgccccctgtcatccatgacccccaccttcgtggag
ttcgacgaccgtattgccattctcggcacccccggcggcagccgcatcatttccatggta
atgctggccgtgctggaagccagcaacaacaaaccagtggaagactgggtcaacgcagtg
cgctaccaccatcaatacctgcccgacgaagtgcaggcggagccggcattcatcgacagc
caagccgcaaaagacttggtacgtagggggcataaggtggtttccactggccgtaactac
ggcaacatgcaggctatactgtggcgccaagatagtggcgaggtcaccgctgccagcgac
ccacgagggatcggtagcgccgaaattcgagccccacattcatccaaggagcaatcaaca
gagtag

DBGET integrated database retrieval system