KEGG   Alcanivorax sp. NBRC 101098: AS19_06780Help
Entry
AS19_06780        CDS       T03879                                 

Definition
(GenBank) rRNA (guanine-N1-)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
aln  Alcanivorax sp. NBRC 101098
Brite
KEGG Orthology (KO) [BR:aln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aln03009]
    AS19_06780
Enzymes [BR:aln01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     AS19_06780
Ribosome biogenesis [BR:aln03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AS19_06780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 MTS Methyltransf_23 Methyltransf_12 Methyltransf_4 Ubie_methyltran PrmA MetW Methyltransf_32 ADH_zinc_N DUF498 zf-TFIIIC
Motif
Other DBs
NCBI-ProteinID: BAP13529
Position
complement(730102..730911)
Genome map
AA seq 269 aa AA seqDB search
MPTLKCPSCEQALRLSDNSWRCDNGHQFDRAKRGYTNLLLAQQRRSRSPGDDKAMVQART
SFLELGRYQPLADALLAHLPDEEPAWLDIGCGEGWYSDQFAQRLGAVNGVGVDISKFAVD
AAAKRNKRVTWLVASGARLPLFDASQQRVFVLFTRLFVDDIARVLQPGGELMVVGTGETH
LLPLREALYDDVRQSGFDASKFLDNRFELLSSETLHCEWIPESEEELRNLLAMTPHHWRA
RPEAKAGIGTLAGKPMNGHFVIQRWRRVA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctacactcaaatgccctagttgcgagcaagcccttcgcctttccgataacagctgg
cgctgcgataacggtcaccagtttgaccgcgccaaacgtggctacaccaatctgttacta
gcacagcaacgccgctcccgttctcctggggacgacaaagccatggtgcaggcgcgcacg
tcatttcttgaattgggccgttatcagccgctagcagacgccctgctggcccacctgcca
gatgaagagcccgcttggctagatattggctgcggtgaaggctggtacagcgatcagttt
gcccagcgactaggggcagtgaatggtgtgggcgtggatatttccaagttcgccgtggat
gccgccgctaagcgtaacaagcgagtcacttggctggtggcgagcggcgctcgcctgcct
ctgtttgatgccagccagcaacgagtgtttgtactgttcactcgcctgtttgtggatgat
atcgcccgggtgctgcaacctggcggggagttaatggttgtgggcaccggtgaaacgcac
ctgctaccgttacgcgaagccctctatgacgatgtgcgccagagtggctttgatgcgagc
aagtttctagataatcgctttgagctactttccagcgagaccctgcattgcgagtggata
cccgagtcagaagaagaactgcgcaacttgctcgctatgacgcctcaccattggcgcgca
cggcccgaagctaaggctggcattggcaccctcgcgggcaagcccatgaacgggcatttt
gtgattcaacgctggcggcgtgtggcgtag

DBGET integrated database retrieval system