KEGG   Alcanivorax sp. NBRC 101098: AS19_07390Help
Entry
AS19_07390        CDS       T03879                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
aln  Alcanivorax sp. NBRC 101098
Pathway
aln00220  Arginine biosynthesis
aln01100  Metabolic pathways
aln01110  Biosynthesis of secondary metabolites
aln01130  Biosynthesis of antibiotics
aln01230  Biosynthesis of amino acids
Module
aln_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:aln00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AS19_07390
Enzymes [BR:aln01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     AS19_07390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: BAP13590
Position
complement(804640..805548)
Genome map
AA seq 302 aa AA seqDB search
MTRHFLTLTDLTPDELGYLIQRAIELKTMLRNGQNHEPLKGKTLGMIFEKSSTRTRVSFE
VAMTHFGGSSIFLSPRDTQLGRGEPIEDSARVLSRMVDAVMIRTFDHATLQTFADHSAVP
VINALTDDFHPCQLLADMQTFVEHRGSIQGKKVVWVGDGNNMCASYINAANQFDFELVIS
CPDGFTPDNDLLGRYPERVSLEADVATAVQGAHLVVTDVWASMGQEDEQQTRLNAFEGYQ
VTPELMDKADPDALFMHCLPAHRGEEVSHEMMDDPRAVVWDEAENRLHAQKALLEFLLTG
QH
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcatttcctgaccctgaccgatctaactccagatgaactcggctacctgatt
cagcgcgccattgagctgaaaaccatgctgcgcaacggccagaaccatgagccattgaaa
ggcaaaacgctgggcatgattttcgaaaaatcatccacccgcacccgggtatcctttgaa
gtagcgatgacccattttggtggctccagcatctttctctcgccccgagacactcagctg
ggccggggtgaaccgattgaagattcagcacgggtactgtcacgcatggtcgatgcggta
atgatccgcacctttgaccacgccaccctgcaaacctttgccgaccactcggcggtaccc
gtgataaacgccctcacggatgacttccacccctgccagctactcgccgacatgcagacg
tttgtagagcatcgcggcagcatccaaggcaagaaagtggtgtgggtcggtgatggcaac
aacatgtgtgccagttacattaacgctgccaaccagtttgatttcgaattggtcatcagc
tgcccagacggcttcaccccagataacgacctgctgggccgctatccggagcgggtcagc
ttagaagcggacgtggccaccgccgtgcaaggcgctcatctggtagtgaccgatgtgtgg
gcttccatgggccaggaagatgaacagcaaacccgccttaacgcgtttgagggttatcaa
gtcacccctgaactaatggacaaagccgatccggatgcgctgttcatgcactgcctgccc
gcccaccgtggcgaagaagtcagccacgaaatgatggacgacccccgcgccgtggtctgg
gacgaagccgaaaaccgcctgcacgcgcagaaagccttgctggaatttctgctcactggc
caacattga

DBGET integrated database retrieval system