KEGG   Alcanivorax sp. NBRC 101098: AS19_10460Help
Entry
AS19_10460        CDS       T03879                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aln  Alcanivorax sp. NBRC 101098
Pathway
aln00071  Fatty acid degradation
aln00072  Synthesis and degradation of ketone bodies
aln00280  Valine, leucine and isoleucine degradation
aln00310  Lysine degradation
aln00362  Benzoate degradation
aln00380  Tryptophan metabolism
aln00620  Pyruvate metabolism
aln00630  Glyoxylate and dicarboxylate metabolism
aln00640  Propanoate metabolism
aln00650  Butanoate metabolism
aln00900  Terpenoid backbone biosynthesis
aln01100  Metabolic pathways
aln01110  Biosynthesis of secondary metabolites
aln01120  Microbial metabolism in diverse environments
aln01130  Biosynthesis of antibiotics
aln01200  Carbon metabolism
aln01212  Fatty acid metabolism
aln02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AS19_10460
   00630 Glyoxylate and dicarboxylate metabolism
    AS19_10460
   00640 Propanoate metabolism
    AS19_10460
   00650 Butanoate metabolism
    AS19_10460
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AS19_10460
   00072 Synthesis and degradation of ketone bodies
    AS19_10460
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AS19_10460
   00310 Lysine degradation
    AS19_10460
   00380 Tryptophan metabolism
    AS19_10460
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AS19_10460
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AS19_10460
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AS19_10460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aln04147]
    AS19_10460
Enzymes [BR:aln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AS19_10460
Exosome [BR:aln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AS19_10460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: BAP13897
Position
1138745..1139953
Genome map
AA seq 402 aa AA seqDB search
MLDAYIYDGLRTPFGRHGGVLASVRPDDLLAGVIRELVQRNGFAASLYEDVVIGNTNQAG
EDARNVARHAGLLAGLPQSVAGITVNRLCGSGLAATLDAARMVTVGEGELIIAGGTESMS
RAPYVMAKAEKAFSREMTVFDSTIGARFPNPKVLKQFGADTMPQTAQNVAHDLGISREDA
DAFAIQSQQRYEVAREQGFYQQEVLPVTVPQGGKATPLRVADDEHPRPGTCVDKLRQLPA
IVDGGIITAGNASGINDGAAAVIVGSRRAGVAAGIAPRARVLSGAVAGVAPRVMGLGPVD
ACNKALARAGLALAQMDVIEINEAFAAQVLGCCKQLGLAGDDERLNPNGGAIAVGHPLGA
SGARLVLTAMRQLERTRGRYALLSLCIGVGQGVAMVLERVDS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgcctatatctacgatggtctgcgtaccccttttggtcgccatggcggcgtt
ctggcatcggtacgcccggatgacctcttggccggagtgattcgcgaactggtacagcga
aatggctttgcggcttctctgtatgaagatgttgtcattggtaatactaatcaggcgggg
gaagatgcccgtaatgtggctcgtcatgccgggttattagctgggttgccgcagtccgtg
gcggggatcaccgtgaataggttatgtggcagcggcctcgccgcaacattggatgcggca
cgtatggtgacggtgggcgagggcgagttgatcattgccggtggtacggaatcgatgagc
cgtgccccttatgtaatggccaaagcagaaaaagcgtttagccgggagatgacagttttc
gatagcactatcggcgcccgcttccctaacccgaaagtgctcaagcagtttggtgccgat
actatgccgcagacggcacagaatgtagcgcacgacctgggtattagccgtgaagatgcg
gatgcttttgctatacagtctcaacaacgctatgaggtcgcccgtgagcaagggttttat
cagcaggaagtgttaccggttacggtgccccaggggggcaaggcgacaccactgcgtgtg
gctgacgacgaacatccccgccccggaacctgcgttgataagttgcgacaactgcctgct
attgtcgatgggggcattattactgcgggtaatgcgtctgggataaatgacggggcggcg
gcagtgattgtgggttcgcgtagggctggtgtggcggcgggtattgctccccgtgctcga
gttctgtctggtgcggttgccggagtggcgcctcgcgttatgggcctaggcccggtggat
gcgtgcaacaaggcattggcccgggcgggcctggcgttagctcagatggatgtgattgaa
attaatgaggcgtttgccgcccaagtgctgggctgctgtaagcagttgggcttggctggg
gatgatgagcgcctgaacccaaatggtggcgctattgctgtcggccatccgttaggtgcg
tccggtgcgcgtttggtcttgactgccatgcgtcagttggagcgaacccgcggtcgttat
gcacttcttagtttgtgcattggcgtaggtcagggcgttgccatggtgctggagagggta
gattcatga

DBGET integrated database retrieval system