KEGG   Alcanivorax sp. NBRC 101098: AS19_17900Help
Entry
AS19_17900        CDS       T03879                                 

Definition
(GenBank) hypothetical protein
  KO
K16317  tRNA (pseudouridine54-N1)-methyltransferase [EC:2.1.1.257]
Organism
aln  Alcanivorax sp. NBRC 101098
Brite
KEGG Orthology (KO) [BR:aln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aln03016]
    AS19_17900
Enzymes [BR:aln01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.257  tRNA (pseudouridine54-N1)-methyltransferase
     AS19_17900
Transfer RNA biogenesis [BR:aln03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    AS19_17900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltrn_RNA_2 SpoU_methylase
Motif
Other DBs
NCBI-ProteinID: BAP14641
Position
1972287..1972889
Genome map
AA seq 200 aa AA seqDB search
MRTFVLRARAASTHSQTLLANVGGDAHSEILAHTLMNAIFVAQSHRDDVVVHLVLESTQD
YSRTITFVAAEMRDIGGFHEQALLAKVVRALDASAGMGKEQMKAVESGITVRTQSFEKVV
KELAEDGHQLYMMDPKGENIRELDFAQKPCFLLTDHIPMPKKSFNSLKRLGTEKISLGPT
MLFASQCVVLINNELDLAGF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccttcgttctccgcgcccgtgccgcttctacccacagccaaaccttgctcgcc
aatgtggggggcgatgcccatagcgagattctggcgcatactttaatgaatgcgatcttt
gtggctcagtcccatcgtgatgacgtggtggtgcatttggtgctggaaagcacccaggac
tattcacgcaccatcacctttgtggcggcggagatgcgagatattggaggcttccatgag
caggcattgctggccaaggtggtacgagctctggacgcctctgccggcatgggcaaggag
cagatgaaggccgtggaaagcggcattaccgtgcgcacacagagttttgagaaggtagtg
aaggaactggccgaggatgggcatcagttatacatgatggacccgaaaggcgagaacatt
cgcgaactagactttgcgcagaaaccctgttttttgctcactgaccatattcccatgccc
aagaagagctttaatagtttaaagcggctgggcacggagaaaatcagtttggggccaacc
atgttgtttgcgtcgcagtgcgtggtgctcattaataatgaactggacttggcggggttc
tga

DBGET integrated database retrieval system