KEGG   Alcanivorax sp. NBRC 101098: AS19_20370Help
Entry
AS19_20370        CDS       T03879                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
aln  Alcanivorax sp. NBRC 101098
Pathway
aln00130  Ubiquinone and other terpenoid-quinone biosynthesis
aln00627  Aminobenzoate degradation
aln01100  Metabolic pathways
aln01110  Biosynthesis of secondary metabolites
aln01120  Microbial metabolism in diverse environments
aln01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aln00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    AS19_20370
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AS19_20370
Enzymes [BR:aln01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     AS19_20370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein DUF3439 RTX
Motif
Other DBs
NCBI-ProteinID: BAP14888
Position
complement(2244138..2244740)
Genome map
AA seq 200 aa AA seqDB search
MTHRVTLAFTGASGAPYGLRLLQCLLEADCEVFVLLSKAARVVIGTETALKLPAGTGNAE
QALRDWVKTEKGRLVVCGLEQWTAPVASGSGAPAAMVVCPCSTGTLSAIAMGASDNLIER
AADVAIKEGRKLILVPRESPFSAIHLENMLKLSRLGVTIMPAAPGFYHQPQSVDDLVDFM
VARLLDHLGVEQTLVKRWGE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacacatcgggtgacgttagcttttaccggtgcctccggagcaccttacgggttacgt
ttgctgcagtgtttgctggaggcggactgtgaggtgttcgttctactttccaaggctgcg
cgagtggtcattggcactgagacggcattgaaattgcctgcgggtaccggcaacgctgag
caggcgttgcgcgattgggtaaagacagaaaagggacggctggtcgtttgtgggttggaa
caatggacggcgccggtggcttccggcagcggagctcctgcagccatggtggtctgcccc
tgctctacggggaccttgtcagccattgcgatgggggccagtgataatctgatcgagcgg
gctgcggatgtggccatcaaggaaggtcgaaaattgattctggtcccccgggaatcgcct
ttctccgcgatccacctggaaaacatgcttaaactttcccgccttggcgtcaccatcatg
cccgccgcgcctgggttttatcatcaaccacaaagcgtggatgatctggtggactttatg
gttgcccggctactggatcatcttggtgtggaacaaaccttagtgaagcgttggggggag
tga

DBGET integrated database retrieval system