KEGG   Alloactinosynnema sp. L-07: CRK56593Help
Entry
CRK56593          CDS       T04489                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
alo  Alloactinosynnema sp. L-07
Pathway
alo00360  Phenylalanine metabolism
alo00362  Benzoate degradation
alo00621  Dioxin degradation
alo00622  Xylene degradation
alo01100  Metabolic pathways
alo01120  Microbial metabolism in diverse environments
alo01220  Degradation of aromatic compounds
Module
alo_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:alo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CRK56593
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CRK56593
   00622 Xylene degradation
    CRK56593
   00621 Dioxin degradation
    CRK56593
Enzymes [BR:alo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     CRK56593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm 3HCDH_RFF Coronavirus_5
Motif
Other DBs
NCBI-ProteinID: CRK56593
UniProt: A0A0H5CH41
Position
I:1590582..1591712
Genome map
AA seq 376 aa AA seqDB search
MGDMTIRPEDVPVVTGEVTESEILANTPAAGGETDLRITDSTLRDGSHAMSHQFTEAQVR
GVVAALDSAGVQVIEVSHGDGLGGSSFNYGFSLVDEFDLIAAAVDEATRAKIAILMLPGL
ATMRDLKRARAVGASVARIATHCTEADVSIQHFGEARALGMETVGFLMLAHRASPEVLAR
QARIMVDAGAQCVYVVDSAGALVLSDAQARVQAVVDEIGPDGAQVGFHGHQNLSMGIANS
VLAYQSGARQIDGALCALGAGAGNSPTEVLAATFERMGIRTGVDLGEVLSAAEEVVRPFI
PRLPWMDRASITQGYAGVYSSFLLHAERAAERYGVPAHAILQKVGEYGYVGGQEDMIIDV
ALQLAQERDLAAVGAR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacatgaccatccgacctgaggacgtccccgtggtgaccggtgaggtgaccgaa
agcgagatcctcgcgaacaccccggcagcggggggcgagacggacctgcggatcaccgac
tcgacattgcgcgacgggtcgcacgcgatgagccaccagttcaccgaagcgcaggtgcgc
ggggtggtcgccgcactggacagcgcgggcgtccaggtgatcgaggtcagccacggcgac
gggctgggcgggtcgagcttcaactacggcttcagcctcgtcgacgagttcgacctcatc
gccgccgcggtcgacgaagcgacccgcgccaagatcgccatcctgatgctcccgggattg
gcgacgatgcgcgacctcaaacgcgcgcgcgccgtgggggcctcggtggccaggatcgcc
acccactgcaccgaagcggacgtgtcgatccagcacttcggcgaggcccgcgcgctcggg
atggagaccgtcgggttcctcatgctcgctcaccgcgcgagcccggaagtgttggcgcgg
caggcaaggatcatggtcgacgcgggcgcgcagtgcgtctacgtggtcgactcggcgggc
gcgctcgtgctgtccgatgcccaggcccgcgtccaggccgtggtggacgagataggcccg
gacggcgcgcaggtgggcttccacggccaccagaacctcagcatgggcatcgcgaactcg
gtgctggcctaccagtctggtgcccgccagatcgacggcgcgctgtgcgcgctcggcgcg
ggcgccgggaattcgccgaccgaggtgctggccgcgaccttcgagcggatggggatccgc
accggtgtcgacctcggcgaggtgctctcggccgccgaggaggtcgttcgcccgttcatc
ccacggctgccctggatggaccgcgcgtcgatcacccagggctatgcgggcgtctactcg
tcgttcctgctgcacgccgagcgggccgccgagcggtacggcgtgcccgcgcacgccatc
ctgcagaaagtgggggagtacggctacgtcggcggccaagaggacatgatcatcgacgtc
gcgctccaactggcgcaggagcgcgacctcgctgcggtgggagcccggtga

DBGET integrated database retrieval system