KEGG   Alloactinosynnema sp. L-07: CRK56647Help
Entry
CRK56647          CDS       T04489                                 

Definition
(GenBank) Esterase/lipase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
alo  Alloactinosynnema sp. L-07
Pathway
alo00903  Limonene and pinene degradation
alo00930  Caprolactam degradation
alo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:alo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CRK56647
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CRK56647
Enzymes [BR:alo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     CRK56647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 Hydrolase_4 Esterase
Motif
Other DBs
NCBI-ProteinID: CRK56647
UniProt: A0A0H5CG60
Position
I:1648139..1649038
Genome map
AA seq 299 aa AA seqDB search
MRPRIDRVRLEGTQLRSLRAAVRVGGVVAGWPGMATIEPVRTSRFSGEWVRTRRARPTGA
VLYLHGGGYVASSPRAYRCVTEPYSRLTRLPVLAVAYRRAPEHPYPAALDDALAAYEWLL
DQGHRPERIALAGDSAGGHLAIGLLTTLAQPNRPMPAAATLFSPLLDPTLTDAIRRDAVR
PDPVMTPTFAARCAAAFHPAGDFADPRLSPLTADLALLRRFPPIQTHVGGTECFAGDSER
LHERLDQAGVANRLFMARGQVHSYVTLNRVVPEARLAVRRAAIFVRSAMGEVRPGRALR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccccggatcgaccgcgtccggctcgaaggcacccaactgcgttctctgcgcgcc
gccgtccgcgtcggcggggtggtggcgggatggcctggcatggcaacgatcgagcccgtc
cggacgtcgcgattctccggcgagtgggtgcggacacgccgcgcacggcccactggcgcc
gtcctctacctgcacggcggcggctatgtcgcctcgtcgccgcgcgcctaccgttgtgtg
accgagccgtattccaggctgaccaggctcccggtgctcgcggtcgcttatcggcgcgcg
ccagagcacccgtatccggcggcgctcgacgacgccctcgcggcgtatgaatggctgctg
gaccaaggccatcggccggagcgcatcgcgctcgcgggtgactccgccggcggacacctg
gcgatcgggctgctgacgaccttggcccagcccaaccgcccgatgcctgccgcggcgacg
ctgttctccccgttgctcgaccccaccctcaccgacgcgatccgccgtgacgccgtgcgt
cctgacccagtgatgacgccaaccttcgccgcccggtgcgccgcggcgttccaccccgcc
ggggacttcgccgaccctcgactctcgccgttgaccgcggatctcgcactgctgcgccgg
ttccctccgatccagacccacgtcggcggcaccgagtgcttcgcaggcgattccgagcgc
ctgcacgagcgactggaccaggccggcgtcgccaacagactgtttatggcgcgtggccag
gtgcactcctacgtcacgctcaaccgggtggtgcccgaggcacgcctggcagtgcgtcga
gccgccatcttcgtccgctccgccatgggtgaggtcaggccggggagagccctccggtga

DBGET integrated database retrieval system