KEGG   Alloactinosynnema sp. L-07: CRK57298Help
Entry
CRK57298          CDS       T04489                                 

Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
alo  Alloactinosynnema sp. L-07
Pathway
alo00220  Arginine biosynthesis
alo01100  Metabolic pathways
alo01110  Biosynthesis of secondary metabolites
alo01130  Biosynthesis of antibiotics
alo01230  Biosynthesis of amino acids
Module
alo_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:alo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CRK57298
Enzymes [BR:alo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CRK57298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CRK57298
UniProt: A0A0H5CJ04
Position
I:complement(2385178..2386101)
Genome map
AA seq 307 aa AA seqDB search
MTRRHLISVDDLGDDDLHWIVRRGAEFAAGRHTGEEPLRDDVVGILFRKTSTRTRTAFAA
GALRLGARIVTYGPDDLQENTGETVEDTAAVLSGMLDVLVARTAGPEAELRAYAAQHRMA
VINAMSAEEHPTQALADLSTLTTRFGRLDGLRVLYVGEGNNTASALTLALSRYHDTQLHL
RTPPGYGVAQRYLDRAAINAKRTGAVVEQRHDADDLPEVDVVYTTRWQTTGTVKPTPDWR
TSFAPFQVDTAMMAACPGAVFMHDLPAHRGEEVTAEVLDGPSSIAFEQAEHKYHSARAVL
QWCAGRS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacccggcgccacctgatctccgtcgacgacctcggcgacgacgacctgcactggatc
gtgcgccgcggcgccgagttcgccgcgggccgccacacgggcgaggaacccctgcgcgat
gacgtcgtgggcatcctgttccgcaagacctccacccgcacccgcaccgcgttcgccgcg
ggcgcgctgcggctgggcgcgcggatcgtcacctacgggcccgacgacctgcaggagaac
accggcgagaccgtcgaggacaccgccgcggtgctctccggcatgctcgacgtgctcgtg
gcccgcaccgcgggacccgaggccgagttgcgcgcctacgccgcgcagcaccgcatggcg
gtgatcaacgcgatgagcgccgaggaacaccccacccaggccctggccgacctgagcacc
ctgaccacccggttcggcaggctcgacgggctgcgcgtgctgtatgtgggggagggcaac
aacaccgcctccgcgctgaccctggccctgtcgcgctaccacgacacccagctgcacctg
cggaccccgcccggctacggcgtggcccagcgctacctggaccgggcggcgatcaacgcc
aagcgcacgggcgcggtcgtcgagcagcgccacgacgccgatgacctgcccgaggtcgac
gtcgtctacacgacccgctggcagaccaccggcaccgtcaagcccaccccggactggcgg
acgagtttcgcgccgttccaagtggacaccgcgatgatggcggcctgcccgggggcggtc
ttcatgcacgacctgcccgcccaccgcggcgaggaggtcaccgccgaggtcctcgacggg
ccgtcgagcatcgccttcgagcaagccgagcacaagtaccacagcgcgcgggccgtactg
cagtggtgcgcggggcgatcatga

DBGET integrated database retrieval system