KEGG   Alloactinosynnema sp. L-07: CRK58839Help
Entry
CRK58839          CDS       T04489                                 

Definition
(GenBank) FIG003879: Predicted amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
alo  Alloactinosynnema sp. L-07
Brite
KEGG Orthology (KO) [BR:alo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CRK58839
Enzymes [BR:alo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CRK58839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase ETF
Motif
Other DBs
NCBI-ProteinID: CRK58839
UniProt: A0A0H5CMQ5
Position
I:4051512..4052285
Genome map
AA seq 257 aa AA seqDB search
MRLGLCQISASADPAANLDLIRAGVAEAAGAAVVLFPEATMSRFGVPLGPVAEPLDGPWA
TAVREIADAAGVVIVAGMFTPAEDGRVRNTLLVTGRGHHLGYDKIHLFDAFGFKESKTVA
PGDTPVVFTVDEVTVGVATCYDVRFPELFRKLADEGAKAILVGASWGAGEGKAEQWELLV
RARALDSTSWVVACGQADPGPTTDTAPLGIGHSLVADPRGRVVGRLGGKPETLVVDIDPD
LADTTRKTIPVLANRRL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgcgactcgggctttgtcagatctcggcgtcggccgacccggccgcgaacctcgacctg
atccgggccggtgtggcggaggcggcgggcgcggcggtcgtgctgttcccggaggcgacg
atgtcccgcttcggggtcccgctgggcccggtggccgagccgctggacggcccgtgggcc
accgccgtgcgggagatcgcggacgcggccggggtggtgatcgtcgccgggatgttcacc
ccggccgaggacgggcgggtgcgcaacaccctgctggtcaccggccgtggccaccacctg
ggctacgacaagatccatctgttcgacgcgttcggcttcaaggagtcgaagaccgtcgcg
cccggcgacactcccgtggtcttcacggtcgacgaggtcaccgtgggcgtggcgacctgc
tacgacgtccgcttcccggagctgttccgcaagctggccgacgagggcgcgaaggcgatc
ctcgtcggcgccagctggggcgcgggcgagggcaaagccgagcagtgggaattactggtc
cgtgcccgcgcgttggactcgacgtcgtgggtcgtcgcctgcggccaggccgacccgggc
ccgaccacggacaccgcgccgctgggcatcgggcacagcctggtcgccgacccacggggc
cgggtggtggggcggttgggcgggaagccggagacgctggtcgtcgacatcgacccggac
ctggccgacacgaccaggaagaccatcccggtgctggcgaaccgcaggctgtag

DBGET integrated database retrieval system