KEGG   Alloactinosynnema sp. L-07: CRK58870Help
Entry
CRK58870          CDS       T04489                                 

Definition
(GenBank) Glutamyl-tRNA synthetase @ Glutamyl-tRNA(Gln) synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
alo  Alloactinosynnema sp. L-07
Pathway
alo00860  Porphyrin and chlorophyll metabolism
alo00970  Aminoacyl-tRNA biosynthesis
alo01100  Metabolic pathways
alo01110  Biosynthesis of secondary metabolites
alo01120  Microbial metabolism in diverse environments
Module
alo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:alo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CRK58870
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CRK58870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:alo01007]
    CRK58870
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:alo03016]
    CRK58870
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:alo02048]
    CRK58870
Enzymes [BR:alo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     CRK58870
Amino acid related enzymes [BR:alo01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   CRK58870
Transfer RNA biogenesis [BR:alo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CRK58870
 Prokaryotic type
   Other AARSs
    CRK58870
Prokaryotic defense system [BR:alo02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    CRK58870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c DUF3248
Motif
Other DBs
NCBI-ProteinID: CRK58870
UniProt: A0A0H5D2S3
Position
I:4081806..4083290
Genome map
AA seq 494 aa AA seqDB search
MSTPDANTPVRARFCPSPTGTPHVGLIRTALFNWAFARHSGGKLVFRIEDTDAARDSEES
YDALLDALRWLGLDWDEGPEVGGDYGPYRQSQRGDRYAEVIRKLTEAGELYESFSTNEEV
DARRKAAGQDPKLGYDNFDRNLTDEERAALRAEGREPTLRLRMPDGAIAFTDLVRGDISF
PADSVPDPVLVRANGQPLYTLVNPVDDALMRITHVLRGEDLLPSTPRQIALYEALQRVGV
AEFTPHFGHLPLVRGEGNKKLSKRDPESNLFAYRERGFVPEGMLNYLALLGWAIADDRDI
FTMAEMVEAFDIGKVSSNPARFDVKKAEAINAEHVRALSHEEFVRRVLPYLISAGVLPAE
PTGAQLATVDAIAPMVQERLIVLSDAVAMVRFLFTPEGEFEPEADSAAKALGADAKPVLD
ASIEALAALDEWTTPAIEGALKAALIDGMGLKPRKAFAPVRVAATGRTVSPPLYESLELL
GRDRTLTRLRAALP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcactccagacgcgaacaccccagtccgagcccgcttctgcccgtcaccgaccggc
accccgcacgtcgggctcatccgtaccgccctgttcaactgggctttcgcccggcacagc
ggcggcaaactcgtcttccgcatcgaggacaccgacgccgcccgcgactccgaggagagc
tatgacgccctcctcgacgcgctgcggtggttgggcctcgactgggacgagggtcccgag
gtcggcggcgactacggcccctaccggcagagtcagcgcggcgaccgctacgccgaggtc
atccgcaagctgaccgaggcgggcgagctctacgagtcgttctcgaccaacgaagaggtc
gacgcgcgccgtaaggcagcgggtcaggaccccaagctcggctacgacaacttcgaccgg
aatctcaccgacgaagaacgtgccgcgctgcgggccgagggtcgcgagccgacgctgcgg
ctgcgcatgcccgacggcgccatcgcgttcaccgacctcgtccgcggcgacatcagcttc
cccgcggacagcgtgccggacccggtgctcgtgcgcgccaacggccagccgctctacacc
ctggtcaacccggtcgacgacgctctcatgcggatcacccacgtgctgcgcggcgaggac
ctgctgccctccaccccgcggcagatcgcgctctacgaggcactgcagcgcgtcggcgtc
gccgaattcaccccccacttcggtcacctgccactcgtgcgcggcgagggcaacaagaaa
ctgtccaagcgcgaccccgagtcgaaccttttcgcctatcgcgagcgcggattcgtcccg
gaaggaatgctgaactatctggcattgcttggttgggccatcgccgacgaccgcgacatc
ttcaccatggccgagatggtcgaggctttcgacatcggcaaggtcagctcgaatccggcc
cgattcgacgtgaagaaggccgaggccatcaatgccgagcacgtgcgcgctctgtcgcat
gaggagttcgtgcgccgcgttctgccgtatctgatttccgccggcgtgctccccgcggag
ccgaccggggcgcaattggccactgtggacgccatcgcgcccatggtgcaggagcggctt
atcgtcctgtcggacgcggtggccatggtgcgcttccttttcacccctgagggtgagttc
gagccggaggcggactcggcggccaaggccttgggcgccgacgccaagccggtcctcgac
gccagcatcgaggcgctggcggcgctggacgagtggaccacaccggccatcgagggcgcc
ctcaaagcggcgctcatcgacggcatgggcctcaagccgcgcaaggcgttcgcgccggtc
cgggtggccgcgaccggtcgcacggtctcgccgccgctctacgagtccctggagctgctc
ggccgcgaccgcaccctcacccgtttgcgcgccgcactgccgtaa

DBGET integrated database retrieval system