KEGG   Alloactinosynnema sp. L-07: CRK59930Help
Entry
CRK59930          CDS       T04489                                 

Definition
(GenBank) GMP synthase [glutamine-hydrolyzing]
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
alo  Alloactinosynnema sp. L-07
Pathway
alo00230  Purine metabolism
alo01100  Metabolic pathways
Module
alo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:alo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CRK59930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:alo01002]
    CRK59930
Enzymes [BR:alo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     CRK59930
Peptidases and inhibitors [BR:alo01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   CRK59930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase GMP_synt_C Peptidase_C26 NAD_synthase QueC tRNA_Me_trans ThiI ATP_bind_3 Asn_synthase
Motif
Other DBs
NCBI-ProteinID: CRK59930
UniProt: A0A0H5D5L3
Position
I:complement(5123054..5124583)
Genome map
AA seq 509 aa AA seqDB search
MDFGAQYAQLIARRVREAQVYSEVVPHTATVAEMLAKEPAAIVLSGGPSSVYADGAPAID
PALFDAGVPVFGICYGFQAMAQALGGTVEHTGTREFGRTDLSVDGGELHDELPARHPVWM
SHGDCVTKAPEGFTVTATSEGAPVAAFENVERRFAGVQYHPEVAHSPHGQEVLRRFLHDV
AGVRPQWTTSSIVDEQVARIKAQVGDGKAICGLSGGVDSAVAAALVHRAIGDRLTCVFVD
HGLLRAGERTQVERDYVSATGVRLITVDARDRFLDALAGVTDPEEKRKIIGREFIRVFEQ
AELDLQAEAGGDKFRFLVQGTLYPDVVESGGGAGAANIKSHHNVGGLPEDLEFELVEPLR
ALFKDEVRRVGLELGLPETIVHRQPFPGPGLGIRIIGEVTGHNLEILRAADAIAREELTA
AGLDRDIWQCPVVLLADVRSVGVQGDGRTYGHPVVLRPVSSEDAMTADWTRLPYDVLERI
STRITNEVSEVNRVVLDVTSKPPGTIEWE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtggacttcggggcgcagtacgcccagctcatcgcccgccgcgtgcgtgaggcgcaggtc
tactccgaggtcgtcccgcacaccgcgaccgtcgcggagatgctcgccaaggagcccgcc
gccatcgtgctgtcgggcggcccgtcgagcgtctacgccgacggcgcccccgcgatcgac
ccggccctgttcgacgccggtgtccccgttttcgggatctgctacggctttcaggccatg
gcgcaggcgctcggcggcaccgtggagcacaccggcacccgcgagttcggccgcaccgac
ctgagcgtcgacggcggcgaactgcacgacgaactgcccgcccggcaccccgtgtggatg
agccacggcgactgcgtcaccaaggccccggagggcttcaccgtcaccgcgacgtccgag
ggcgctcccgtggccgcgttcgagaacgtcgagcgccggttcgcgggcgtgcagtaccac
ccggaggtcgcgcactccccgcacggccaggaggtgctgcgccgcttcctgcacgacgtc
gccggtgttcgtccacagtggaccacctcgtcgatcgtcgacgagcaggtcgcgcggatc
aaggcccaggtcggcgacggcaaggcgatctgcgggctgtccggcggcgtcgactccgcg
gtcgcggccgccctggtgcaccgggccatcggcgaccggctgacctgcgtgttcgtcgac
catggcctgctgcgcgcaggcgagcggacccaggtcgagcgcgactacgtctcggccacc
ggcgtgcggctgatcaccgtcgacgcgcgcgaccgcttcctcgacgcgctggccggggtc
accgaccccgaggagaagcgcaagatcatcggtcgcgagttcatccgggtcttcgagcag
gccgaactggacctgcaggccgaggcgggcggcgacaagttccgctttctggtccagggc
accctctaccccgatgtggtcgagtccggcggcggcgcgggcgcggcgaacatcaagagc
caccacaacgtcggcggcctgccggaggacctggagttcgaactggtcgagccgctgcgc
gcgctgttcaaggacgaggtgcgccgggtcggcctggaactgggcctgcccgagacgatc
gtgcaccgccagcccttccccggccccggcctgggcatccggatcatcggcgaggtcacc
gggcacaacctggagatcctgcgcgcggccgacgccatcgcccgcgaggaactcaccgcg
gcgggtctggaccgcgacatctggcagtgcccggtcgtgctgctggccgacgtgcgcagc
gtcggcgtgcagggcgacggccgcacctacggccacccggtcgtgctgcgcccggtgtcc
agcgaggacgcgatgaccgccgactggacccgcctgccctacgacgtcctggagcggatc
tccacccggatcaccaacgaggtgtccgaggtcaaccgggtcgtcctcgacgtgacgagc
aagccgccgggcaccatcgagtgggagtga

DBGET integrated database retrieval system