KEGG   Alloactinosynnema sp. L-07: CRK59933Help
Entry
CRK59933          CDS       T04489                                 

Definition
(GenBank) Salicylate hydroxylase
  KO
K05712  3-(3-hydroxy-phenyl)propionate hydroxylase [EC:1.14.13.127]
Organism
alo  Alloactinosynnema sp. L-07
Pathway
alo00360  Phenylalanine metabolism
alo01100  Metabolic pathways
alo01120  Microbial metabolism in diverse environments
alo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:alo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CRK59933
Enzymes [BR:alo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.127  3-(3-hydroxyphenyl)propanoate hydroxylase
     CRK59933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO Pyr_redox_3 Thi4 HI0933_like NAD_binding_8 FAD_binding_2 Amino_oxidase Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: CRK59933
UniProt: A0A0H5CQ38
Position
I:complement(5128143..5129699)
Genome map
AA seq 518 aa AA seqDB search
MNGEDVVTWAWLGAVVTVLIVGAGPVGLTGALLLARKGIPSVVLESRQQRAVMGSRAICV
QRDVLDILERVGVGWKVVDAGVTWYSGRIFYREHEVVTMAFPEPPPGQFPPFVNTPQNVV
EGLLEAEVAAEPLIDLRYDHPVTGLRQDDDGVTVAAGGREFDGSHCIAADGSRSTARDLL
GLPFDGRSFEDKFLITDIRAKLDYPVPERRFYFDPDWNPGRQVLLHPQPDSVWRIDWQVP
EDYDLAADQAGDGLHTRIRQVIGEIDYDLIWASVYRFHQRRVPRMRVGRVFLAGDAAHVM
SPFGARGMNSGLADVENAAWKIAATHAGWAGGALLSTYDTERGAAADENLAVTAATMRFL
VPADATERAHRHEILERSVRDPSVRSQIDSGKLSEPFWYLDSPLTTPSGESDFPTEPGVP
RPPVPGVLCPDVPLPDGTRLRDKFGPWFTVLAAPGVELPELPDHVTVVPVPPDAAALLTL
GESGAAVVRPDGYLAAVSRGPDVDQEVISALSRGAGHQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggtgaagacgttgtcacttgggcgtggctgggggcggtcgtgactgtcctgatc
gtcggcgcgggtccggtcgggctgaccggcgcgctcctgttggcccgcaagggaatcccc
agcgtcgtgctggagtcgaggcagcagcgcgcggtcatgggcagtcgcgcgatctgcgtc
cagcgcgacgtgctcgacatcctcgaacgcgtcggcgtcggatggaaggtggtcgacgcc
ggggtcacctggtactcgggccggatcttctaccgcgagcacgaggtcgtgacgatggcc
ttcccggagccgccgccggggcagttcccgccgttcgtcaacacgccgcagaacgtggtc
gaggggctgctggaagccgaggtggccgccgagccgctgatcgacctgcgctacgaccac
ccggtcacgggcctgcgccaggacgacgacggcgtcaccgtggccgcgggtggacgcgag
ttcgacggcagccactgcatcgccgccgacggctcccgctcgaccgcgcgcgacctgctg
ggactgccgttcgacggccgctccttcgaggacaagttcctgatcaccgacatccgcgcg
aagctggactacccggtcccggagcggcgcttctacttcgacccggactggaatcctggc
aggcaggtgctgctgcacccccagcccgactcggtttggcggatcgactggcaggtcccc
gaggactacgacctggccgcggaccaggcgggcgacggcctgcacacccgcattcgccag
gtgatcggcgagatcgactacgacctgatctgggcgtcggtctaccgcttccatcagcgc
cgggtgccccggatgcgggtcggccgggtctttctggcaggcgacgcggcccacgtgatg
agcccgttcggcgcccgcggcatgaactccgggctcgccgacgtcgagaacgccgcttgg
aagatcgccgccacccacgcgggttgggcgggcggggccctcctgtccacctacgacacc
gaacgcggcgccgccgccgacgagaacctcgccgtcaccgccgccaccatgcgcttcctg
gtccccgccgacgccaccgaacgagcccaccgccacgagatcctcgaacgcagcgtgcgc
gatccgtccgtgcgctctcagatcgactcggggaagctctcggaacccttctggtacctg
gactcgccgctcaccacgccgagcggcgagtcggacttccccaccgagccgggcgtaccc
cgccctccggtccccggcgtcctctgtcccgacgtgccacttcccgacggcactcgatta
cgggacaagttcgggccctggttcacggtgctggccgcgccgggggtcgagctgcccgag
cttccggaccacgtcacggtcgttccggtcccgccggacgcggccgccctgctgacactg
ggcgagtcgggagccgccgtggtccgcccagatggctacctggccgccgtgtcgcgcggc
cccgatgtcgatcaggaggtgataagcgcgctgtctcggggagccgggcatcaatag

DBGET integrated database retrieval system