KEGG   Alloactinosynnema sp. L-07: CRK60878Help
Entry
CRK60878          CDS       T04489                                 

Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
alo  Alloactinosynnema sp. L-07
Pathway
alo00310  Lysine degradation
alo01100  Metabolic pathways
alo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:alo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CRK60878
Enzymes [BR:alo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     CRK60878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO
Motif
Other DBs
NCBI-ProteinID: CRK60878
UniProt: A0A0H5CSE9
Position
I:complement(6010896..6012017)
Genome map
AA seq 373 aa AA seqDB search
MGRGHRVTVLEKEAHWAGHQTGHNSNVVHAGLYYAPGSFKAKMSVAGNRSIVEFAREHGV
PVEVCGKLVVATDESELPALGVLAERAEANGVPAKLISQAEARDYEPEVACVSALRVEST
GIIDFPAVCAALVRLLTDAGADLRLSTPALGIRPGRMGGVEIATGTEVLRADALVNCAGL
HSDRIARMAGLTPKAKIVPFRGEYYELKPERAHLVRGLIYPVPDASLPFLGVHLTRMLDG
SVHAGPNAVLALRREGYRWRDFSAKDLAETARFPGVWKLARKYAYPIGLDEVRRSLSRRR
FAASLAKLVPAVGPDDIVRSGAGVRAQALLPDGSMVQDFLIESAPNQVHVLNAPSPAATC
ALEIGKYIADQVD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcgtgggcaccgggtcaccgtgctggagaaggaagcccactgggcgggccaccag
accggacacaactcgaacgtcgtgcacgcgggcctgtactacgcgcccggctcgttcaag
gcgaagatgtcggtggcgggcaaccgctcgatcgtcgagttcgcccgcgagcacggcgtg
cccgtcgaggtgtgcggcaagctcgtggtcgccaccgacgagtcggagctgcccgcgctg
ggcgtgctggccgagcgggccgaggccaacggtgttcccgccaagctgatctcccaggcc
gaggcgcgcgactacgagcccgaggtggcctgcgtgtcggcgctgcgggtggagagcacc
ggcatcatcgacttccccgccgtgtgcgccgcgctggtgcggctactcaccgacgcgggc
gccgacctgcggctgtccacccccgcgctgggcatccggccggggcgcatgggcggggtg
gagatcgccaccggcaccgaggtgctccgggccgacgcgctggtcaactgcgcgggcctg
cacagcgaccggatcgcgcggatggccgggctcacccccaaggccaagatcgttccgttc
cgcggcgagtactacgagctcaagcccgagcgcgcccacctggtccgcggcctgatctac
ccggtgccggacgcgtcgctgccgttcctcggcgtgcacctgacccggatgctcgacggc
agcgtgcacgcgggccccaacgccgtgctcgcgctgcgccgcgagggctaccgctggcgc
gacttctcggccaaggacctcgccgagaccgcccgtttccccggtgtgtggaagctggcc
cgcaagtacgcctatccgatcggcctcgacgaggtccgccgctcgctgtcgcggcgccgg
ttcgccgccagcctggccaagctcgtgcccgcggtcggccccgacgacatcgtgcgctcc
ggcgccggggtgcgggcgcaggcgctgctgcccgacgggtctatggtccaggacttcctt
atcgagagcgcacccaaccaggtgcacgtgctcaacgcgccgtccccagccgcgacctgc
gcgctggagatcggcaagtacatcgccgaccaggtcgactga

DBGET integrated database retrieval system