KEGG   Alloactinosynnema sp. L-07: CRK61021Help
Entry
CRK61021          CDS       T04489                                 

Definition
(GenBank) NADPH-dependent FMN reductase family protein
  KO
K00299  FMN reductase [EC:1.5.1.38]
Organism
alo  Alloactinosynnema sp. L-07
Pathway
alo00740  Riboflavin metabolism
alo00920  Sulfur metabolism
alo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alo00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CRK61021
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CRK61021
Enzymes [BR:alo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.38  FMN reductase (NADPH)
     CRK61021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2
Motif
Other DBs
NCBI-ProteinID: CRK61021
UniProt: A0A0H5CSF4
Position
I:6148100..6148660
Genome map
AA seq 186 aa AA seqDB search
MTVSVVGIGGSLRTDSQSERALRIALAGAAEAGAKTTALSGADLVLPFYDPAVPERSREA
MRLVDELREADGVILVSPGYHGTVSGLVKNALDYVEDLRDDTRPYLDGRAVGCIATASGW
QASVTTLQALRSVVHALRGWPTPLGAAVNSAEVLFDGGGECSDPQVSTSLRTIGLQVVEF
ALARAT
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtgtcggtggtcggaatcggtgggtccctgcggacagactctcagtccgagcgc
gcgctgcggatcgcgctggccggggccgctgaggcgggtgcgaagacaaccgccttgtcc
ggcgccgatctggtgctcccgttctacgatcctgccgtgccggagcgctcgcgcgaagcc
atgcggctggtcgacgaacttcgcgaggccgatggtgtgatcctcgtctcacccggctac
cacggcaccgtgtccgggctggtcaagaacgccctggactacgtcgaggacctgcgcgac
gacacccgcccctacctcgacggccgcgccgtgggctgcatcgccaccgcgtcgggttgg
caggcgtcggtgacgacgctgcaggcgctgcggtcggtcgtgcacgcgctgcgcggctgg
ccgacgccgctgggcgcggcggtgaactccgccgaggtcctgttcgacggcggcggcgag
tgcagcgacccgcaggtctcgacgagcctgcggaccatcggcctgcaggtcgtcgagttc
gccttggcccgcgctacctga

DBGET integrated database retrieval system