KEGG   Arcobacter sp. LPB0137: LPB137_00290Help
Entry
LPB137_00290      CDS       T04722                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
alp  Arcobacter sp. LPB0137
Brite
KEGG Orthology (KO) [BR:alp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LPB137_00290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 PGA2 K-cyclin_vir_C Cauli_AT RRP36 SKA2
Motif
Other DBs
NCBI-ProteinID: APW64378
UniProt: A0A1P8KIK6
Position
62344..63924
Genome map
AA seq 526 aa AA seqDB search
MDIKTFDSIDKATEKTVSSFAKLSLALLFMVVVFLWSYTSHGDVPNNTFLVIGAVFGAYM
AMNIGANDVANNVGPAVGSKAMTLMWAIIIAATFEALGAFVAGGDVVKTIKKGIIDPALI
SDPQIFIWAMTAALLSAALWLNFATSVGAPVSTTHSIVGGVMGAGIAAAGFSIVDWGTMG
KIAASWVISPVLGGIIAAAFLYLIKTKIVYKKDMVSSAKIIVPYLIAVMTWAFSTYLILK
GIKRLIKLDFFTAAGIALIIAVIAYILVKPLIAKAADKLENTRVSVNTLFTVPLIFAAAL
LSFAHGANDVANAIGPLAAINDAVMNSEIHSKVDIPFWVMAVGALGIAVGLALYGPKLIK
TVGSEITELDQMRAYSIAMAASITVIIASQLGLPVSSTHIAVGGVFGVGFLREYLDSNES
RFLQGLRKKFKKHKKELDSMTKELDELEKLESKSKTNYVRIVELYKSIEEKQEIVKQEKK
DVKEAKSVKYVKRDAVKKIIAAWVITVPAAAILSAAVFFMIKGIMA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ttggatattaaaactttcgattctatagataaagctactgagaaaacagtttcaagcttt
gctaaactttcacttgcattactttttatggtagtagtttttctttggtcttatacttca
catggtgatgttccaaataacacatttttagttattggtgcagtatttggtgcatatatg
gctatgaatattggtgctaatgatgttgcaaacaacgtaggacctgctgttggttcaaaa
gcaatgacattaatgtgggcaattataattgcagctacatttgaagctcttggtgctttt
gttgcaggtggtgatgttgttaagactattaaaaaaggtattattgatcctgctttaatt
tctgaccctcaaatctttatttgggctatgacagctgctttattatcagctgcactttgg
cttaactttgcaacatctgttggagctccagtttcaactactcactcaattgttggtggt
gttatgggtgcaggtattgcagcagcaggtttttctattgtagattggggaacaatgggt
aaaattgctgcttcttgggttatatctcctgttttaggtggaattattgctgcagctttt
ctttatcttattaaaactaagattgtttataaaaaagatatggttagttccgcaaaaata
attgttccttatttaatagctgttatgacttgggcattttctacttatttaattttaaaa
ggtattaaaagattaataaaattagacttctttactgctgctggaattgctttaataatt
gcagtaatagcatatatattagtaaaaccattaattgcaaaagctgcagataagcttgaa
aatacaagagttagtgttaatacactatttacagttcctttaatttttgcagctgcactt
ttatcatttgctcatggtgctaatgatgttgcaaatgcaattggaccattagctgctatt
aatgatgctgttatgaactctgaaattcattcaaaagttgatattccattttgggtaatg
gcagttggtgctttaggtattgccgttggacttgcattatatggaccaaagcttattaaa
acagttggttctgaaattactgaattagaccaaatgagagcttattcaattgctatggct
gcatctattactgttattattgcatctcaacttggactccctgtttcttcaactcatatt
gcagttggtggtgtatttggggtaggttttttacgagaatatttagattctaatgaaagt
agatttttacaaggtttaagaaaaaagtttaaaaagcataaaaaagaattagactcaatg
actaaagagcttgatgaattagaaaaacttgaatcaaagtctaaaactaattatgtaaga
attgttgaattatacaaaagtattgaagaaaaacaagagattgtaaaacaagagaaaaaa
gacgttaaagaagctaaaagtgttaagtatgtaaaaagagatgcagttaaaaagattatt
gctgcatgggttattactgtacctgctgctgctattctatcagctgcagtattctttatg
ataaaaggaattatggcttaa

DBGET integrated database retrieval system